ENO3 Antibody


Western Blot: ENO3 Antibody [H00002027-A01] - Detection against Immunogen (31.61 KDa).

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

ENO3 Antibody Summary

ENO3 (NP_001967 228 a.a. - 277 a.a.) partial recombinant protein with GST tag. KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
ENO3 - enolase 3 (beta, muscle)
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Whole antisera with 50% Glycerol
No Preservative


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ENO3 Antibody

  • 2-phospho-D-glycerate hydrolyase
  • 2-phospho-D-glycerate hydro-lyase
  • beta-enolase
  • EC 4.2.1
  • EC
  • enolase 3 (beta, muscle)
  • Enolase 3
  • enolase 3, (beta, muscle)
  • GSD13
  • MSE
  • Muscle-specific enolase
  • Skeletal muscle enolase


This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ENO3 Antibody (H00002027-A01) (0)

There are no publications for ENO3 Antibody (H00002027-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENO3 Antibody (H00002027-A01) (0)

There are no reviews for ENO3 Antibody (H00002027-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ENO3 Antibody (H00002027-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ENO3 Products

Bioinformatics Tool for ENO3 Antibody (H00002027-A01)

Discover related pathways, diseases and genes to ENO3 Antibody (H00002027-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENO3 Antibody (H00002027-A01)

Discover more about diseases related to ENO3 Antibody (H00002027-A01).

Pathways for ENO3 Antibody (H00002027-A01)

View related products by pathway.

PTMs for ENO3 Antibody (H00002027-A01)

Learn more about PTMs related to ENO3 Antibody (H00002027-A01).

Blogs on ENO3

There are no specific blogs for ENO3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ENO3 Antibody and receive a gift card or discount.


Gene Symbol ENO3