Endophilin A1/SH3GL2 Antibody

Images

 
Western Blot: Endophilin A1/SH3GL2 Antibody [NBP1-79629] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Endophilin A1/SH3GL2 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human SH3GL2The immunogen for this antibody is SH3GL2. Peptide sequence PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3GL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SH3GL2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Endophilin A1/SH3GL2 Antibody

  • CNSA2
  • CNSA2FLJ25015
  • EEN-B1
  • EEN-B1bA335L15.1 (SH3-domain GRB2-like 2)
  • Endophilin A1
  • Endophilin-1
  • endophilin-A1
  • FLJ20276
  • SH3 domain protein 2A
  • SH3 domain-containing GRB2-like protein 2
  • SH3D2A
  • SH3D2AEndophilin A1 BAR domain
  • SH3-domain GRB2-like 2
  • SH3GL2
  • SH3P4
  • SH3P4endophilin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-85614
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-90201
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-02834
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87842
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-87561
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP1-84419
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-88996
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP1-90063
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-81824
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Endophilin A1/SH3GL2 Antibody (NBP1-79629) (0)

There are no publications for Endophilin A1/SH3GL2 Antibody (NBP1-79629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Endophilin A1/SH3GL2 Antibody (NBP1-79629) (0)

There are no reviews for Endophilin A1/SH3GL2 Antibody (NBP1-79629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Endophilin A1/SH3GL2 Antibody (NBP1-79629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Endophilin A1/SH3GL2 Products

Bioinformatics Tool for Endophilin A1/SH3GL2 Antibody (NBP1-79629)

Discover related pathways, diseases and genes to Endophilin A1/SH3GL2 Antibody (NBP1-79629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endophilin A1/SH3GL2 Antibody (NBP1-79629)

Discover more about diseases related to Endophilin A1/SH3GL2 Antibody (NBP1-79629).
 

Pathways for Endophilin A1/SH3GL2 Antibody (NBP1-79629)

View related products by pathway.

PTMs for Endophilin A1/SH3GL2 Antibody (NBP1-79629)

Learn more about PTMs related to Endophilin A1/SH3GL2 Antibody (NBP1-79629).
 

Research Areas for Endophilin A1/SH3GL2 Antibody (NBP1-79629)

Find related products by research area.

Blogs on Endophilin A1/SH3GL2

There are no specific blogs for Endophilin A1/SH3GL2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Endophilin A1/SH3GL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GL2
Uniprot