Endophilin A1/SH3GL2 Antibody

Images

 
Western Blot: SH3GL2 Antibody [NBP1-79628] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Endophilin A1/SH3GL2 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the N terminal of human SH3GL2The immunogen for this antibody is SH3GL2. Peptide sequence INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3GL2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Publications
Read Publication using
NBP1-79628 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Endophilin A1/SH3GL2 Antibody

  • CNSA2
  • CNSA2FLJ25015
  • EEN-B1
  • EEN-B1bA335L15.1 (SH3-domain GRB2-like 2)
  • Endophilin A1
  • Endophilin-1
  • endophilin-A1
  • FLJ20276
  • SH3 domain protein 2A
  • SH3 domain-containing GRB2-like protein 2
  • SH3D2A
  • SH3D2AEndophilin A1 BAR domain
  • SH3-domain GRB2-like 2
  • SH3GL2
  • SH3P4
  • SH3P4endophilin-1

Background

Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Endophilin A1/SH3GL2 Antibody (NBP1-79628)(1)

We have publications tested in 1 confirmed species: Xenopus.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Xenopus
(1)
All Species

Reviews for Endophilin A1/SH3GL2 Antibody (NBP1-79628) (0)

There are no reviews for Endophilin A1/SH3GL2 Antibody (NBP1-79628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Endophilin A1/SH3GL2 Antibody (NBP1-79628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Endophilin A1/SH3GL2 Products

Research Areas for Endophilin A1/SH3GL2 Antibody (NBP1-79628)

Find related products by research area.

Blogs on Endophilin A1/SH3GL2

There are no specific blogs for Endophilin A1/SH3GL2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Endophilin A1/SH3GL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GL2
Uniprot