EMR4P Antibody (1G10) - Azide and BSA Free Summary
| Immunogen |
EMR4P (XP_377506, 21 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ADGRE4P |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
| Application Notes |
This antibody is useful for ELISA, Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for EMR4P Antibody (1G10) - Azide and BSA Free
Background
This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. Thus, the protein would lack a transmembrane domain and the protein encoded by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, the possibility also exists that this gene may represent a transcribed pseudogene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Neut, WB
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for EMR4P Antibody (H00326342-M02) (0)
There are no publications for EMR4P Antibody (H00326342-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EMR4P Antibody (H00326342-M02) (0)
There are no reviews for EMR4P Antibody (H00326342-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EMR4P Antibody (H00326342-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EMR4P Products
Research Areas for EMR4P Antibody (H00326342-M02)
Find related products by research area.
|
Blogs on EMR4P