EMR4P Antibody (1G10)


Western Blot: EMR4P Antibody (1G10) [H00326342-M02] - EMR4P monoclonal antibody (M02), clone 1G10. Analysis of EMR4P expression in HeLa.
Immunocytochemistry/ Immunofluorescence: EMR4P Antibody (1G10) [H00326342-M02] - Analysis of monoclonal antibody to EMR4P on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF

Order Details

EMR4P Antibody (1G10) Summary

EMR4P (XP_377506, 21 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is useful for ELISA, Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EMR4P Antibody (1G10)

  • egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene
  • egf-like module containing, mucin-like, hormone receptor-like 4
  • Egf-tm7
  • EMR4
  • EMR4EGF-like module receptor 4
  • Fire
  • Gpr127
  • GPR127G-protein coupled receptor 127
  • G-protein coupled receptor PGR16
  • PGR16
  • PGR16G protein-coupled receptor 127


This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. Thus, the protein would lack a transmembrane domain and the protein encoded by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, the possibility also exists that this gene may represent a transcribed pseudogene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu
Species: Hu
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Neut
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for EMR4P Antibody (H00326342-M02) (0)

There are no publications for EMR4P Antibody (H00326342-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMR4P Antibody (H00326342-M02) (0)

There are no reviews for EMR4P Antibody (H00326342-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EMR4P Antibody (H00326342-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional EMR4P Products

Array H00326342-M02

Bioinformatics Tool for EMR4P Antibody (H00326342-M02)

Discover related pathways, diseases and genes to EMR4P Antibody (H00326342-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for EMR4P Antibody (H00326342-M02)

View related products by pathway.

Research Areas for EMR4P Antibody (H00326342-M02)

Find related products by research area.

Blogs on EMR4P

There are no specific blogs for EMR4P, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EMR4P Antibody (1G10) and receive a gift card or discount.


Gene Symbol ADGRE4P