Recombinant Human EMP3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EMP3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-163 of Human EMP3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE

Protein/Peptide Type
Recombinant Protein
Gene
EMP3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EMP3 Protein

  • EMP3
  • EMP-3
  • epithelial membrane protein 3
  • HNMP-1
  • Protein YMP
  • YMP
  • YMPHematopoietic neural membrane protein 1

Background

EMP3( AAH09718, 1 a.a. - 164 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBL1-10259
Species: Hu
NBP1-86847
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15012
Species: Hu
AF7288
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-62297
Species: Hu
Applications: WB
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003249-P01
Species: Hu
Applications: WB
AF756
Species: Mu
Applications: WB, IHC
NBP2-38736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
AF2777
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP

Publications for EMP3 Recombinant Protein (H00002014-P01) (0)

There are no publications for EMP3 Recombinant Protein (H00002014-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMP3 Recombinant Protein (H00002014-P01) (0)

There are no reviews for EMP3 Recombinant Protein (H00002014-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMP3 Recombinant Protein (H00002014-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EMP3 Products

Bioinformatics Tool for EMP3 Recombinant Protein (H00002014-P01)

Discover related pathways, diseases and genes to EMP3 Recombinant Protein (H00002014-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMP3 Recombinant Protein (H00002014-P01)

Discover more about diseases related to EMP3 Recombinant Protein (H00002014-P01).
 

Pathways for EMP3 Recombinant Protein (H00002014-P01)

View related products by pathway.

PTMs for EMP3 Recombinant Protein (H00002014-P01)

Learn more about PTMs related to EMP3 Recombinant Protein (H00002014-P01).
 

Research Areas for EMP3 Recombinant Protein (H00002014-P01)

Find related products by research area.

Blogs on EMP3

There are no specific blogs for EMP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EMP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EMP3
Entrez