EMMPRIN/CD147 Recombinant Protein Antigen

Images

 
There are currently no images for EMMPRIN/CD147 Recombinant Protein Antigen (NBP2-57810PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EMMPRIN/CD147 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EMMPRIN/CD147.

Source: E. coli

Amino Acid Sequence: EIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BSG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57810.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EMMPRIN/CD147 Recombinant Protein Antigen

  • 5F7
  • basigin (Ok blood group)
  • Basigin
  • BSG
  • CD147 antigen
  • CD147
  • Collagenase stimulatory factor
  • EMMPRIN
  • EMMPRINTCSF
  • Extracellular matrix metalloproteinase inducer
  • Leukocyte activation antigen M6
  • M6
  • OK blood group antigen
  • OK
  • Tumor cell-derived collagenase stimulatory factor

Background

CD147 plays a pivotal role in spermatogenesis, embryo implantation, neural network formation and tumor progression. It stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). CD147 may target monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to plasma membranes of retinal pigment epithelium and neural retina. CD147 also seems to be a receptor for oligomannosidic glycans. In vitro, it promotes outgrowth of astrocytic processes. CD147 forms homooligomers in a cis-dependent manner on the plasma membrane. It forms a complex with MMP1 at the tumor cell surface. CD147 interacts with SLC16A1 and SLC1A3; probably a BSG dimer is associated with a monocarboxylate transporter dimer. CD147 also interacts with ATP1B2, MAG and L1CAM.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
DMP900
Species: Hu
Applications: ELISA
NBP1-59656
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
MAB901
Species: Hu
Applications: IHC, IP, KO, Neut, WB
MAB9181
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-03626
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-33660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-81251
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP2-57810PEP
Species: Hu
Applications: AC

Publications for EMMPRIN/CD147 Recombinant Protein Antigen (NBP2-57810PEP) (0)

There are no publications for EMMPRIN/CD147 Recombinant Protein Antigen (NBP2-57810PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMMPRIN/CD147 Recombinant Protein Antigen (NBP2-57810PEP) (0)

There are no reviews for EMMPRIN/CD147 Recombinant Protein Antigen (NBP2-57810PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EMMPRIN/CD147 Recombinant Protein Antigen (NBP2-57810PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EMMPRIN/CD147 Products

Research Areas for EMMPRIN/CD147 Recombinant Protein Antigen (NBP2-57810PEP)

Find related products by research area.

Blogs on EMMPRIN/CD147.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EMMPRIN/CD147 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BSG