Emerin Antibody (10Y5K9)

Western Blot: Emerin Antibody (10Y5K9) [NBP3-16351] - Western blot analysis of various lysates using Emerin Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunohistochemistry-Paraffin: Emerin Antibody (10Y5K9) [NBP3-16351] - Immunohistochemistry of paraffin-embedded human colon using Emerin Rabbit mAb (NBP3-16351) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Emerin Antibody (10Y5K9) [NBP3-16351] - Confocal imaging of HeLa cells using Emerin Rabbit mAb . The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 10Y5K9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Emerin Antibody (10Y5K9) Summary

• Description: Novus Biologicals Rabbit Emerin Antibody (10Y5K9) (NBP3-16351) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-254 of human Emerin (P50402). RERPMYGRDSAYQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLFFIYHFMQAEEGNPF
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: EMD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Emerin Antibody (10Y5K9)

• emerin
• Emery-Dreifuss muscular dystrophy
• LEM domain containing 5
• STAEDMDLEMD5

Background

Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Dreifuss-Emery muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the emerin gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EMD