Ellis van Creveld syndrome Antibody

Images

 
Immunohistochemistry-Paraffin: Ellis van Creveld syndrome Antibody [NBP1-84039] - Staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ellis van Creveld syndrome Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVMDLLEAQLETQLQEAEQNFISELAALARVPLAESKLLPAKRGLLEKPLRTKRKKPLPQERGDLGVPNNEDLASGDQTSGSLSSKRLSQQESEAGDSGNSKKMLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EVC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Ellis van Creveld syndrome Protein (NBP1-84039PEP)
Publications
Read Publication using
NBP1-84039 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24996003).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ellis van Creveld syndrome Antibody

  • Ellis van Creveld syndrome
  • ellis-van Creveld syndrome protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47467
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
1705-HH/CF
Species: Hu, Mu
NBP1-57016
Species: Hu
Applications: WB
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32343
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC

Publications for Ellis van Creveld syndrome Antibody (NBP1-84039)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Ellis van Creveld syndrome Antibody (NBP1-84039) (0)

There are no reviews for Ellis van Creveld syndrome Antibody (NBP1-84039). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Ellis van Creveld syndrome Antibody (NBP1-84039) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ellis van Creveld syndrome Products

Bioinformatics Tool for Ellis van Creveld syndrome Antibody (NBP1-84039)

Discover related pathways, diseases and genes to Ellis van Creveld syndrome Antibody (NBP1-84039). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ellis van Creveld syndrome Antibody (NBP1-84039)

Discover more about diseases related to Ellis van Creveld syndrome Antibody (NBP1-84039).
 

Pathways for Ellis van Creveld syndrome Antibody (NBP1-84039)

View related products by pathway.

PTMs for Ellis van Creveld syndrome Antibody (NBP1-84039)

Learn more about PTMs related to Ellis van Creveld syndrome Antibody (NBP1-84039).

Blogs on Ellis van Creveld syndrome

There are no specific blogs for Ellis van Creveld syndrome, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ellis van Creveld syndrome Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EVC