ELL3 Antibody - Azide and BSA Free

Western Blot: ELL3 Antibody [H00080237-B02P] - Analysis of ELL3 expression in transfected 293T cell line by ELL3 polyclonal antibody. Lane 1: ELL3 transfected lysate(43.67 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ELL3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ELL3 Antibody - Azide and BSA Free (H00080237-B02P) is a polyclonal antibody validated for use in WB. Anti-ELL3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ELL3 (NP_079441.1, 1 a.a. - 397 a.a.) full-length human protein. MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS
• Specificity: ELL3 - elongation factor RNA polymerase II-like 3,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ELL3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ELL3 Antibody - Azide and BSA Free

• elongation factor RNA polymerase II-like 3
• FLJ22637
• RNA polymerase II elongation factor ELL3

Background

Elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressingtransient pausing by the polymerase at multiple sites along the DNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ELL3 Antibody (H00080237-B02P)(1)

Publication using H00080237-B02P

• Alexander LMM, Watters J, Reusch JA et al. Selective expression of the transcription elongation factor ELL3 in B cells prior to ELL2 drives proliferation and survival. Mol Immunol 2017-08-28 [PMID: 28858629]

Bioinformatics

• Gene Symbol: ELL3
• Entrez:
  • 80237(Human)
• Uniprot:
  • NP_079441.1(Human)