Elk-1 Antibody (10U8X1)

Western Blot: Elk-1 Antibody (10U8X1) [NBP3-15631] - Western blot analysis of extracts of various cell lines, using Elk-1 antibody (NBP3-15631) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.

Immunoprecipitation: Elk-1 Antibody (10U8X1) [NBP3-15631] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Elk-1 antibody (NBP3-15631). Western blot was performed from the immunoprecipitate using Elk-1 antibody (NBP3-15631) at a dilition of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP
• Clone: 10U8X1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Elk-1 Antibody (10U8X1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 329-428 of human Elk-1 (NP_001107595.1). GGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ELK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Elk-1 Antibody (10U8X1)

• Elk1
• Elk-1
• ELK1, member of ETS oncogene family
• ETS domain-containing protein Elk-1
• ETS-like gene 1

Background

ELK is a member of the family of genes homologous to the v-Ets oncogene isolated from the E26 eythroblastosis virus. Members of this family exhibit varied patterns of tissue expression. They also share a highly conserved C-terminal domain that may be responsible for the DNA binding activity of all members of the Ets gene family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELK1