ELAVL4 Antibody [DyLight 594] Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ELAVL4 (NP_068771.2).
Sequence: MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ELAVL4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for ELAVL4 Antibody [DyLight 594]
Background
ELAVL4 may play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR. Binds to AU-rich sequences (AREs) of target mRNAs, includingVEGF and FOS mRNA
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Hu, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: BA
Publications for ELAVL4 Antibody (NBP3-35160DL594) (0)
There are no publications for ELAVL4 Antibody (NBP3-35160DL594).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ELAVL4 Antibody (NBP3-35160DL594) (0)
There are no reviews for ELAVL4 Antibody (NBP3-35160DL594).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ELAVL4 Antibody (NBP3-35160DL594) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ELAVL4 Products
Research Areas for ELAVL4 Antibody (NBP3-35160DL594)
Find related products by research area.
|
Blogs on ELAVL4