EIG121 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EIG121 Antibody [NBP2-57699] - Staining of human cell line MCF7 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human prostate shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining in human prostate and liver tissues using anti-KIAA1324 antibody. Corresponding KIAA1324 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human cerebral cortex, liver, lymph node and prostate using Anti-KIAA1324 antibody NBP2-57699 (A) shows similar ...read more
Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human lymph node.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EIG121 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ELPHGFASLSANMELDDSAAESTGNCTSSKWVPRGDYIASNTDECTATLMYAVNLKQSGTVNFEYYYPDSSI
Specificity
Specificity of human EIG121 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1324
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EIG121 Recombinant Protein Antigen (NBP2-57699PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EIG121 Antibody

  • estrogen-induced gene 121 protein
  • hypothetical protein LOC57535
  • KIAA1324
  • MGC150624

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, V, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
NBP3-05061
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-38632
Species: Hu
Applications: WB, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-31054
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57699
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for EIG121 Antibody (NBP2-57699) (0)

There are no publications for EIG121 Antibody (NBP2-57699).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIG121 Antibody (NBP2-57699) (0)

There are no reviews for EIG121 Antibody (NBP2-57699). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EIG121 Antibody (NBP2-57699) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EIG121 Products

Bioinformatics Tool for EIG121 Antibody (NBP2-57699)

Discover related pathways, diseases and genes to EIG121 Antibody (NBP2-57699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIG121 Antibody (NBP2-57699)

Discover more about diseases related to EIG121 Antibody (NBP2-57699).
 

Pathways for EIG121 Antibody (NBP2-57699)

View related products by pathway.

Blogs on EIG121

There are no specific blogs for EIG121, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIG121 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1324