![Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining in human prostate and liver tissues using anti-KIAA1324 antibody. Corresponding KIAA1324 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/EIG121-Antibody-Immunohistochemistry-Paraffin-NBP2-57699-img0004.jpg "Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining in human prostate and liver tissues using anti-KIAA1324 antibody. Corresponding KIAA1324 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit EIG121 Antibody - BSA Free (NBP2-57699) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-EIG121 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ELPHGFASLSANMELDDSAAESTGNCTSSKWVPRGDYIASNTDECTATLMYAVNLKQSGTVNFEYYYPDSSI |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ELAPOR1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P, Retrieval method: HIER pH6. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for EIG121 Antibody (NBP2-57699)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ELAPOR1 |
![Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human cerebral cortex, liver, lymph node and prostate using Anti-KIAA1324 antibody NBP2-57699 (A) shows similar protein distribution across tissues to independent antibody NBP1-90479 (B).](http://images.novusbio.com/fullsize/EIG121-Antibody-Immunohistochemistry-Paraffin-NBP2-57699-img0005.jpg "Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human cerebral cortex, liver, lymph node and prostate using Anti-KIAA1324 antibody NBP2-57699 (A) shows similar protein distribution across tissues to independent antibody NBP1-90479 (B).")
![Immunocytochemistry/Immunofluorescence: EIG121 Antibody [NBP2-57699] - Staining of human cell line MCF7 shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/EIG121-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57699-img0001.jpg "Immunocytochemistry/Immunofluorescence: EIG121 Antibody [NBP2-57699] - Staining of human cell line MCF7 shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/EIG121-Antibody-Immunohistochemistry-Paraffin-NBP2-57699-img0006.jpg "Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/EIG121-Antibody-Immunohistochemistry-Paraffin-NBP2-57699-img0002.jpg "Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human prostate shows high expression.](http://images.novusbio.com/fullsize/EIG121-Antibody-Immunohistochemistry-Paraffin-NBP2-57699-img0003.jpg "Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human prostate shows high expression.")
![Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human lymph node.](http://images.novusbio.com/fullsize/EIG121-Antibody-Immunohistochemistry-Paraffin-NBP2-57699-img0007.jpg "Immunohistochemistry-Paraffin: EIG121 Antibody [NBP2-57699] - Staining of human lymph node.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")