EIG121 Antibody

Images

 
Immunohistochemistry-Paraffin: EIG121 Antibody [NBP1-90479] - Staining of human salivary gland shows granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EIG121 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLCYNDCTFSRNTPTRTFNYNFSALANTVTLAGGPSFTSKGLKYFHHFTLSLCGNQGRKMSVCTDNVTDLRIPEGESGFSKSITAYVCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVTTDMTLDGITSPAELFHLESLGIPDVIF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1324
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EIG121 Protein (NBP1-90479PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EIG121 Antibody

  • estrogen-induced gene 121 protein
  • hypothetical protein LOC57535
  • KIAA1324
  • MGC150624

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-07799
Species: Hu
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF1384
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
1827-SF/CF
Species: Hu
AF6144
Species: Hu
Applications: WB, Simple Western
NB100-2412
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90479
Species: Hu
Applications: IHC, IHC-P

Publications for EIG121 Antibody (NBP1-90479) (0)

There are no publications for EIG121 Antibody (NBP1-90479).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIG121 Antibody (NBP1-90479) (0)

There are no reviews for EIG121 Antibody (NBP1-90479). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EIG121 Antibody (NBP1-90479) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIG121 Products

Bioinformatics Tool for EIG121 Antibody (NBP1-90479)

Discover related pathways, diseases and genes to EIG121 Antibody (NBP1-90479). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIG121 Antibody (NBP1-90479)

Discover more about diseases related to EIG121 Antibody (NBP1-90479).
 

Pathways for EIG121 Antibody (NBP1-90479)

View related products by pathway.

Blogs on EIG121

There are no specific blogs for EIG121, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIG121 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1324