Recombinant Human EIF3M Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EIF3M Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-374 of Human EIF3M full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Protein/Peptide Type
Recombinant Protein
Gene
EIF3M

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EIF3M Protein

  • B5 receptor
  • dendritic cell protein
  • eIF3m
  • eukaryotic translation initiation factor 3 subunit M
  • eukaryotic translation initiation factor 3, subunit M
  • Fetal lung protein B5
  • FLJ29030
  • GA17
  • HFLB5
  • hfl-B5
  • PCI domain containing 1 (herpesvirus entry mediator)
  • PCI domain-containing protein 1
  • PCID1B5

Background

HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBL1-11228
Species: Hu
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for EIF3M Recombinant Protein (H00010480-P01) (0)

There are no publications for EIF3M Recombinant Protein (H00010480-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3M Recombinant Protein (H00010480-P01) (0)

There are no reviews for EIF3M Recombinant Protein (H00010480-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF3M Recombinant Protein (H00010480-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EIF3M Products

Bioinformatics Tool for EIF3M Recombinant Protein (H00010480-P01)

Discover related pathways, diseases and genes to EIF3M Recombinant Protein (H00010480-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF3M Recombinant Protein (H00010480-P01)

Discover more about diseases related to EIF3M Recombinant Protein (H00010480-P01).
 

Pathways for EIF3M Recombinant Protein (H00010480-P01)

View related products by pathway.

PTMs for EIF3M Recombinant Protein (H00010480-P01)

Learn more about PTMs related to EIF3M Recombinant Protein (H00010480-P01).

Blogs on EIF3M

There are no specific blogs for EIF3M, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EIF3M Antibody
NBP1-83552

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EIF3M Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3M