We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

EIF3G Recombinant Protein Antigen

Images

 
There are currently no images for EIF3G Protein (NBP1-84872PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EIF3G Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF3G.

Source: E. coli

Amino Acid Sequence: ICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF3G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84872.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EIF3G Recombinant Protein Antigen

  • eIF3 p42
  • eIF3 p44
  • eIF-3-delta
  • eIF3-delta
  • eIF3g
  • EIF3-P42
  • eIF3-p44
  • EIF3S4eIF-3 RNA-binding subunit
  • Eukaryotic translation initiation factor 3 RNA-binding subunit
  • Eukaryotic translation initiation factor 3 subunit 4
  • eukaryotic translation initiation factor 3 subunit G
  • eukaryotic translation initiation factor 3 subunit p42
  • eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD)
  • eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa
  • eukaryotic translation initiation factor 3, subunit G

Background

Eukaryotic initiation factor 3 subunit G (eIF3G) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3G has been shown to directly interact with AIF (apoptosis inducing factor), a protein that plays a role in caspase-independent apoptosis. AIF is able to inhibit protein synthesis via its interaction with eIF3g.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84874
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-18891
Species: Hu, Mu
Applications: IP, WB
NB100-93302
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-84869
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP2-24572
Species: Ca, Eq, Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
H00010561-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-511
Species: Hu, Mu
Applications: IP, WB
NBP2-13954
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC,  IHC-P
NBP1-82778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84022
Species: Hu
Applications: IHC,  IHC-P, WB
409-ML
Species: Mu
Applications: BA
NBP1-83007
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38366
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-84872PEP
Species: Hu
Applications: AC

Publications for EIF3G Protein (NBP1-84872PEP) (0)

There are no publications for EIF3G Protein (NBP1-84872PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3G Protein (NBP1-84872PEP) (0)

There are no reviews for EIF3G Protein (NBP1-84872PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EIF3G Protein (NBP1-84872PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EIF3G Products

Research Areas for EIF3G Protein (NBP1-84872PEP)

Find related products by research area.

Blogs on EIF3G

There are no specific blogs for EIF3G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EIF3G Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3G