Recombinant Human EIF3G GST (N-Term) Protein

SDS-Page: Recombinant Human EIF3G Protein [H00008666-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human EIF3G GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 221-320 of Human EIF3G
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: GASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: EIF3G
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EIF3G GST (N-Term) Protein

• eIF3 p42
• eIF3 p44
• eIF-3-delta
• eIF3-delta
• eIF3g
• EIF3-P42
• eIF3-p44
• EIF3S4eIF-3 RNA-binding subunit
• Eukaryotic translation initiation factor 3 RNA-binding subunit
• Eukaryotic translation initiation factor 3 subunit 4
• eukaryotic translation initiation factor 3 subunit G
• eukaryotic translation initiation factor 3 subunit p42
• eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD)
• eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa
• eukaryotic translation initiation factor 3, subunit G

Background

Eukaryotic initiation factor 3 subunit G (eIF3G) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3G has been shown to directly interact with AIF (apoptosis inducing factor), a protein that plays a role in caspase-independent apoptosis. AIF is able to inhibit protein synthesis via its interaction with eIF3g.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: EIF3G