EIF2G Antibody - BSA Free

Western Blot: EIF2G Antibody [NBP3-03513] - Western blot analysis of extracts of various cell lines, using EIF2G antibody (NBP3-03513) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: EIF2G Antibody [NBP3-03513] - Paraffin-embedded rat brain using EIF2G antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: EIF2G Antibody [NBP3-03513] - Paraffin-embedded human liver using EIF2G antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: EIF2G Antibody [NBP3-03513] - Paraffin-embedded human stomach using EIF2G antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EIF2G Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EIF2G Antibody - BSA Free (NBP3-03513) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human EIF2G (NP_001406.1). MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF2S3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for EIF2G Antibody - BSA Free

• EIF2
• eIF-2gA
• eIF-2-gamma X
• EIF2gamma
• EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD)
• eIF-2gX
• eukaryotic translation initiation factor 2 subunit 3
• Eukaryotic translation initiation factor 2 subunit gamma X
• eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
• eukaryotic translation initiation factor 2G

Background

eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiatortRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex.Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound toeIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round ofinitiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: EIF2S3