EIF2AK1 Antibody


Western Blot: EIF2AK1 Antibody [NBP1-56484] - Human Hela, Antibody Dilution: 1.0 ug/ml EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in HeLa.
Immunohistochemistry-Paraffin: EIF2AK1 Antibody [NBP1-56484] - Human Lung tissue, 5ug/ml.
Western Blot: EIF2AK1 Antibody [NBP1-56484] - Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Lung

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

EIF2AK1 Antibody Summary

Synthetic peptides corresponding to EIF2AK1(eukaryotic translation initiation factor 2-alpha kinase 1) The peptide sequence was selected from the N terminal of EIF2AK1. Peptide sequence TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against EIF2AK1 and was validated on Western blot.
EIF2AK1 Lysate (NBP2-64826)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EIF2AK1 Antibody

  • EC 2.7.11
  • eukaryotic translation initiation factor 2-alpha kinase 1
  • HCR
  • heme sensitive initiation factor 2a kinase
  • Heme-controlled repressor
  • Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase
  • Heme-regulated inhibitor
  • heme-regulated initiation factor 2-alpha kinase
  • heme-regulated repressor
  • Hemin-sensitive initiation factor 2-alpha kinase
  • KIAA1369heme regulated initiation factor 2 alpha kinase


EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.The HRI gene is localized to 7p22 where its 3' end slightly overlaps the 3' end of the gene JTV1. The two genes are transcribed from opposite strands. Studies in rat and rabbit suggest that the HRI gene product phosphorylates the alpha subunit of eukaryotic initiation factor 2. Its kinase activity is induced by low levels of heme and inhibited by the presence of heme. Sequence Note: The sequence AF181071.1 is a chimeric mRNA clone. Only the heme-regulated initiation factor 2-alpha kinase region was propagated into this RefSeq record.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for EIF2AK1 Antibody (NBP1-56484) (0)

There are no publications for EIF2AK1 Antibody (NBP1-56484).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2AK1 Antibody (NBP1-56484) (0)

There are no reviews for EIF2AK1 Antibody (NBP1-56484). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF2AK1 Antibody (NBP1-56484) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for EIF2AK1 Antibody (NBP1-56484)

Discover related pathways, diseases and genes to EIF2AK1 Antibody (NBP1-56484). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF2AK1 Antibody (NBP1-56484)

Discover more about diseases related to EIF2AK1 Antibody (NBP1-56484).

Pathways for EIF2AK1 Antibody (NBP1-56484)

View related products by pathway.

PTMs for EIF2AK1 Antibody (NBP1-56484)

Learn more about PTMs related to EIF2AK1 Antibody (NBP1-56484).

Research Areas for EIF2AK1 Antibody (NBP1-56484)

Find related products by research area.

Blogs on EIF2AK1

There are no specific blogs for EIF2AK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EIF2AK1 Antibody and receive a gift card or discount.


Gene Symbol EIF2AK1