EHD1 Antibody

Images

 
Western Blot: EHD1 Antibody [NBP2-56035] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: EHD1 Antibody [NBP2-56035] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EHD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEQPGTAASPVSGSMFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLP
Specificity
Specificity of human EHD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EHD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EHD1 Recombinant Protein Antigen (NBP2-56035PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EHD1 Antibody

  • EH-domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-16287
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56931
Species: Hu
Applications: ICC/IF
19540002
Species: Hu
Applications: ELISA, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7869
Species: Hu
Applications: WB, ICC
NBP1-82949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00085377-B01P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-92310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56035
Species: Hu
Applications: WB, ICC/IF

Publications for EHD1 Antibody (NBP2-56035) (0)

There are no publications for EHD1 Antibody (NBP2-56035).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EHD1 Antibody (NBP2-56035) (0)

There are no reviews for EHD1 Antibody (NBP2-56035). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EHD1 Antibody (NBP2-56035) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EHD1 Antibody (NBP2-56035)

Discover related pathways, diseases and genes to EHD1 Antibody (NBP2-56035). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EHD1 Antibody (NBP2-56035)

Discover more about diseases related to EHD1 Antibody (NBP2-56035).
 

Pathways for EHD1 Antibody (NBP2-56035)

View related products by pathway.

PTMs for EHD1 Antibody (NBP2-56035)

Learn more about PTMs related to EHD1 Antibody (NBP2-56035).

Blogs on EHD1

There are no specific blogs for EHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EHD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EHD1