EHD1 Antibody


Orthogonal Strategies: Western Blot: EHD1 Antibody [NBP2-56035] - Analysis in human cell line A-431 and human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: EHD1 Antibody [NBP2-56035] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, KO
Validated by:

Orthogonal Strategies


Order Details

EHD1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEQPGTAASPVSGSMFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLP
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Knockout Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Knockout validation (PMID: 31988382).
Control Peptide
EHD1 Recombinant Protein Antigen (NBP2-56035PEP)
Read Publication using
NBP2-56035 in the following applications:

  • KO
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for EHD1 Antibody

  • EH-domain containing 1


The EHD1 gene belongs to a highly conserved gene family encoding EPS15 homology (EH) domain-containing proteins. The protein-binding EH domain was first noted in EPS15, a substrate for the epidermal growth factor receptor. The EH domain has been shown to be a


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for EHD1 Antibody (NBP2-56035)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: KO, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for EHD1 Antibody (NBP2-56035) (0)

There are no reviews for EHD1 Antibody (NBP2-56035). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EHD1 Antibody (NBP2-56035) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EHD1 Products

Diseases for EHD1 Antibody (NBP2-56035)

Discover more about diseases related to EHD1 Antibody (NBP2-56035).

Pathways for EHD1 Antibody (NBP2-56035)

View related products by pathway.

PTMs for EHD1 Antibody (NBP2-56035)

Learn more about PTMs related to EHD1 Antibody (NBP2-56035).

Research Areas for EHD1 Antibody (NBP2-56035)

Find related products by research area.

Blogs on EHD1

There are no specific blogs for EHD1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EHD1 Antibody and receive a gift card or discount.


Gene Symbol EHD1