Recombinant Human EFS Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human EFS Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 369-468 of Human EFS

Source: Wheat Germ

Amino Acid Sequence: QANQPPRLFVPHSKRVVVAAHRLVFVGDTLGRLAASAPLRAQVRAAGTALGQALRATVLAVKGAALGYPSSPAIQEMVQCVTELAGQALQFTTLLTSLAP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
EFS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EFS Protein

  • CAS3
  • CASS3Cas scaffolding protein family member 3
  • EFS1
  • EFS2
  • embryonal Fyn-associated substrate
  • HEFS
  • signal transduction protein (SH3 containing)
  • SIN

Background

EFS - embryonal Fyn-associated substrate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
H00005555-P01
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-66139
Species: Hu
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB4077
Species: Hu
Applications: WB, IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB100-1699
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
H00010278-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for EFS Partial Recombinant Protein (H00010278-Q01) (0)

There are no publications for EFS Partial Recombinant Protein (H00010278-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EFS Partial Recombinant Protein (H00010278-Q01) (0)

There are no reviews for EFS Partial Recombinant Protein (H00010278-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EFS Partial Recombinant Protein (H00010278-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EFS Products

Bioinformatics Tool for EFS Partial Recombinant Protein (H00010278-Q01)

Discover related pathways, diseases and genes to EFS Partial Recombinant Protein (H00010278-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EFS Partial Recombinant Protein (H00010278-Q01)

Discover more about diseases related to EFS Partial Recombinant Protein (H00010278-Q01).
 

Pathways for EFS Partial Recombinant Protein (H00010278-Q01)

View related products by pathway.

PTMs for EFS Partial Recombinant Protein (H00010278-Q01)

Learn more about PTMs related to EFS Partial Recombinant Protein (H00010278-Q01).

Blogs on EFS

There are no specific blogs for EFS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EFS Antibody
NBP2-31993
iNOS Antibody
NB300-605

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EFS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EFS