Recombinant Human EFHD2 Protein

Images

 
SDS-Page: Recombinant Human EFHD2 Protein [H00079180-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Recombinant Human EFHD2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-240 of Human EFHD2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
EFHD2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EFHD2 Protein

  • EF hand domain containing 2
  • EF hand domain family, member D2
  • EF-hand domain family, member D2
  • EF-hand domain-containing protein D2
  • MGC4342
  • swiprosin 1
  • swiprosin-1
  • SWS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00080303-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49180
Species: Hu
Applications: IHC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP2-37585
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00079180-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE

Publications for EFHD2 Recombinant Protein (H00079180-P01) (0)

There are no publications for EFHD2 Recombinant Protein (H00079180-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EFHD2 Recombinant Protein (H00079180-P01) (0)

There are no reviews for EFHD2 Recombinant Protein (H00079180-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EFHD2 Recombinant Protein (H00079180-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EFHD2 Products

Bioinformatics Tool for EFHD2 Recombinant Protein (H00079180-P01)

Discover related pathways, diseases and genes to EFHD2 Recombinant Protein (H00079180-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EFHD2 Recombinant Protein (H00079180-P01)

Discover more about diseases related to EFHD2 Recombinant Protein (H00079180-P01).
 

Pathways for EFHD2 Recombinant Protein (H00079180-P01)

View related products by pathway.

PTMs for EFHD2 Recombinant Protein (H00079180-P01)

Learn more about PTMs related to EFHD2 Recombinant Protein (H00079180-P01).

Blogs on EFHD2

There are no specific blogs for EFHD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EFHD2 Antibody
NB100-1477

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EFHD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EFHD2