EFHD1 Antibody (3D10)

Western Blot: EFHD1 Antibody (3D10) [H00080303-M11] - Analysis of EFHD1 expression in transfected 293T cell line by EFHD1 monoclonal antibody (M11), clone 3D10. Lane 1: EFHD1 transfected lysatE (27 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3D10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

EFHD1 Antibody (3D10) Summary

• Immunogen: EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN
• Specificity: EFHD1 - EF-hand domain family, member D1 (3D10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EFHD1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EFHD1 Antibody (3D10)

• DKFZp781H0842
• EF-hand domain family, member D1
• EF-hand domain-containing protein 1
• EF-hand domain-containing protein D1
• member D1
• MST133
• MSTP133
• swiprosin-2

Background

EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EFHD1
• Entrez:
  • 80303(Human)
• Uniprot:
  • NP_079478(Human)