EFHD1 Antibody (3D10)

Images

 
Western Blot: EFHD1 Antibody (3D10) [H00080303-M11] - Analysis of EFHD1 expression in transfected 293T cell line by EFHD1 monoclonal antibody (M11), clone 3D10. Lane 1: EFHD1 transfected lysatE (27 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EFHD1 Antibody (3D10) Summary

Immunogen
EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN
Specificity
EFHD1 - EF-hand domain family, member D1 (3D10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EFHD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EFHD1 Antibody (3D10)

  • DKFZp781H0842
  • EF-hand domain family, member D1
  • EF-hand domain-containing protein 1
  • EF-hand domain-containing protein D1
  • member D1
  • MST133
  • MSTP133
  • swiprosin-2

Background

EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1477
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00006005-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00010908-M08
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF-249-NA
Species: Hu
Applications: Neut, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-24655
Species: Hu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-1028
Species: Ca, Fe, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, PEP-ELISA, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB

Publications for EFHD1 Antibody (H00080303-M11) (0)

There are no publications for EFHD1 Antibody (H00080303-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EFHD1 Antibody (H00080303-M11) (0)

There are no reviews for EFHD1 Antibody (H00080303-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EFHD1 Antibody (H00080303-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EFHD1 Products

Bioinformatics Tool for EFHD1 Antibody (H00080303-M11)

Discover related pathways, diseases and genes to EFHD1 Antibody (H00080303-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EFHD1 Antibody (H00080303-M11)

Discover more about diseases related to EFHD1 Antibody (H00080303-M11).
 

Pathways for EFHD1 Antibody (H00080303-M11)

View related products by pathway.

Research Areas for EFHD1 Antibody (H00080303-M11)

Find related products by research area.

Blogs on EFHD1

There are no specific blogs for EFHD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EFHD1 Antibody (3D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol EFHD1
Entrez
Uniprot