EFHD1 Antibody (1A8) - Azide and BSA Free

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09] - Analysis of EFHD1 expression in NIH/3T3 (Cat # L018V1).

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09] - Analysis of EFHD1 expression in PC-12 (Cat # L012V1).

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09] - Analysis of EFHD1 expression in Raw 264.7 (Cat # L024V1).

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09] - Analysis of EFHD1 expression in K-562 (Cat # L009V1).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 1A8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EFHD1 Antibody (1A8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse EFHD1 Antibody (1A8) - Azide and BSA Free (H00080303-M09) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN
• Specificity: EFHD1 (1A8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EFHD1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EFHD1 Antibody (1A8) - Azide and BSA Free

• DKFZp781H0842
• EF-hand domain family, member D1
• EF-hand domain-containing protein 1
• EF-hand domain-containing protein D1
• member D1
• MST133
• MSTP133
• swiprosin-2

Background

EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EFHD1
• Entrez:
  • 80303(Human)
• Uniprot:
  • NP_079478(Human)