We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

EEN Recombinant Protein Antigen

Images

 
There are currently no images for EEN Protein (NBP1-85522PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EEN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SH3GL1.

Source: E. coli

Amino Acid Sequence: VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SH3GL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85522.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EEN Recombinant Protein Antigen

  • CNSA1endophilin-2
  • EEN fusion partner of MLL
  • EENSH3 domain-containing GRB2-like protein 1
  • Endophilin-2
  • extra 11-19 leukemia fusion
  • Extra eleven-nineteen leukemia fusion gene protein
  • MGC111371
  • SH3 domain protein 2B
  • SH3-containing Grb-2-like 1 protein
  • SH3D2Bendophilin-A2
  • SH3-domain GRB2-like 1
  • SH3P8

Background

Endophilin A2 is an SH3 domain containing protein implicated in endocytosis. It has been identified in human acute leukemia as a fusion partner of MLL (mixed-lineage leukemia). Because of its involvement in this chromosomal translocation, endophilin A2 is also known as EEN (extra eleven nineteen).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006456-M01
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, IP, S-ELISA, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-84419
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92892
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-13955
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr,  IHC-P
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-59845
Species: Hu
Applications: IHC,  IHC-P, IP (-), WB
M6000B
Species: Mu
Applications: ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-85522PEP
Species: Hu
Applications: AC

Publications for EEN Protein (NBP1-85522PEP) (0)

There are no publications for EEN Protein (NBP1-85522PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEN Protein (NBP1-85522PEP) (0)

There are no reviews for EEN Protein (NBP1-85522PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EEN Protein (NBP1-85522PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EEN Products

Array NBP1-85522PEP

Blogs on EEN

There are no specific blogs for EEN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EEN Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GL1