EEF1G Antibody

Images

 
Immunohistochemistry-Paraffin: EEF1G Antibody [NBP2-68716] - Staining of human testis.
Independent Antibodies: Immunohistochemistry-Paraffin: EEF1G Antibody [NBP2-68716] - Staining of human cerebellum, cerebral cortex, lymph node and testis using Anti-EEF1G antibody NBP2-68716 (A) shows similar ...read more
Immunohistochemistry-Paraffin: EEF1G Antibody [NBP2-68716] - Staining of human cerebellum.
Immunohistochemistry-Paraffin: EEF1G Antibody [NBP2-68716] - Staining of human lymph node.
Immunohistochemistry-Paraffin: EEF1G Antibody [NBP2-68716] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

EEF1G Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDI
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EEF1G
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide
EEF1G Recombinant Protein Antigen (NBP2-68716PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for EEF1G Antibody

  • eEF-1B gamma
  • EF-1-gamma
  • EF1Gelongation factor 1-gamma
  • eukaryotic translation elongation factor 1 gamma
  • GIG35
  • pancreatic tumor-related protein
  • PRO1608
  • translation elongation factor eEF-1 gamma chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31310
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-94502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83420
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP3-04426
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-75686
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
AF8537
Species: Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-31317
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45910
Species: Hu
Applications: WB, IHC
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76910
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for EEF1G Antibody (NBP2-68716) (0)

There are no publications for EEF1G Antibody (NBP2-68716).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEF1G Antibody (NBP2-68716) (0)

There are no reviews for EEF1G Antibody (NBP2-68716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EEF1G Antibody (NBP2-68716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EEF1G Products

Bioinformatics Tool for EEF1G Antibody (NBP2-68716)

Discover related pathways, diseases and genes to EEF1G Antibody (NBP2-68716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEF1G Antibody (NBP2-68716)

Discover more about diseases related to EEF1G Antibody (NBP2-68716).
 

Pathways for EEF1G Antibody (NBP2-68716)

View related products by pathway.

Research Areas for EEF1G Antibody (NBP2-68716)

Find related products by research area.

Blogs on EEF1G

There are no specific blogs for EEF1G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EEF1G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EEF1G