EEF1E1 Antibody - Azide and BSA Free

Western Blot: EEF1E1 Antibody [NBP2-92227] - Analysis of extracts of various cell lines, using EEF1E1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: EEF1E1 Antibody [NBP2-92227] - Analysis of L929 cells using EEF1E1 at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EEF1E1 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EEF1E1 (NP_004271.1). MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EEF1E1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for EEF1E1 Antibody - Azide and BSA Free

• AIMP3Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3
• ARS-interacting multifunctional protein 3
• Elongation factor p18
• eukaryotic translation elongation factor 1 epsilon 1
• eukaryotic translation elongation factor 1 epsilon-1
• Multisynthase complex auxiliary component p18
• p18 component of aminoacyl-tRNA synthetase complex
• P18

Background

EEF1E1 encodes a multifunctional protein that localizes both in the cytoplasm and in the nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage and plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: EEF1E1