EEF1D Antibody


Western Blot: EEF1D Antibody [NBP2-56820] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: EEF1D Antibody [NBP2-56820] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli fibrillar center & cytosol.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

EEF1D Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPPALAPWGLCTHGNQVACHHVTWGIWVNKSS
Specificity of human EEF1D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EEF1D Recombinant Protein Antigen (NBP2-56820PEP)

Reactivity Notes

Mouse 80%, Rat 81%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for EEF1D Antibody

  • Antigen NY-CO-4
  • EF-1D
  • EF-1-delta
  • EF1DFP1047
  • elongation factor 1-delta
  • eukaryotic translation elongation factor 1 delta (guanine nucleotide exchangeprotein)
  • FLJ20897
  • guanine nucleotide exchange protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EEF1D Antibody (NBP2-56820) (0)

There are no publications for EEF1D Antibody (NBP2-56820).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEF1D Antibody (NBP2-56820) (0)

There are no reviews for EEF1D Antibody (NBP2-56820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EEF1D Antibody (NBP2-56820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for EEF1D Antibody (NBP2-56820)

Discover related pathways, diseases and genes to EEF1D Antibody (NBP2-56820). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEF1D Antibody (NBP2-56820)

Discover more about diseases related to EEF1D Antibody (NBP2-56820).

Pathways for EEF1D Antibody (NBP2-56820)

View related products by pathway.

PTMs for EEF1D Antibody (NBP2-56820)

Learn more about PTMs related to EEF1D Antibody (NBP2-56820).

Blogs on EEF1D

There are no specific blogs for EEF1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EEF1D Antibody and receive a gift card or discount.


Gene Symbol EEF1D