EEF1B2 Antibody (3A5)

Images

 
Western Blot: EEF1B2 Antibody (3A5) [H00001933-M10] - Analysis of EEF1B2 expression in HeLa (Cat # L013V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EEF1B2 Antibody (3A5) Summary

Immunogen
EEF1B2 (NP_001950.1, 29 a.a. - 91 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSG
Specificity
EEF1B2 - eukaryotic translation elongation factor 1 beta 2 (3A5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EEF1B2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00001933-M10.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EEF1B2 Antibody (3A5)

  • EEF1B
  • EEF1B1
  • EF1B
  • EF-1-beta
  • elongation factor 1-beta
  • eukaryotic translation elongation factor 1 beta 1
  • eukaryotic translation elongation factor 1 beta 2

Background

This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-89605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-513
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-98474
Species: Hu
Applications: WB
NBP1-49832
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27072
Species: Hu, Am, Bv, Ca, Eq, Op, Pm
Applications: WB, IHC-P
NBP1-81714
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
H00001933-M10
Species: Hu
Applications: WB, ELISA

Publications for EEF1B2 Antibody (H00001933-M10)(1)

Reviews for EEF1B2 Antibody (H00001933-M10) (0)

There are no reviews for EEF1B2 Antibody (H00001933-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EEF1B2 Antibody (H00001933-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EEF1B2 Products

Bioinformatics Tool for EEF1B2 Antibody (H00001933-M10)

Discover related pathways, diseases and genes to EEF1B2 Antibody (H00001933-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEF1B2 Antibody (H00001933-M10)

Discover more about diseases related to EEF1B2 Antibody (H00001933-M10).
 

Pathways for EEF1B2 Antibody (H00001933-M10)

View related products by pathway.

Blogs on EEF1B2

There are no specific blogs for EEF1B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EEF1B2 Antibody (3A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol EEF1B2
Entrez
Uniprot