EEF1B2 Antibody (3A5) - Azide and BSA Free

Western Blot: EEF1B2 Antibody (3A5) [H00001933-M10] - Analysis of EEF1B2 expression in HeLa (Cat # L013V1).

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 3A5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EEF1B2 Antibody (3A5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: EEF1B2 (NP_001950.1, 29 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSG
• Specificity: EEF1B2 - eukaryotic translation elongation factor 1 beta 2 (3A5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EEF1B2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EEF1B2 Antibody (3A5) - Azide and BSA Free

• EEF1B
• EEF1B1
• EF1B
• EF-1-beta
• elongation factor 1-beta
• eukaryotic translation elongation factor 1 beta 1
• eukaryotic translation elongation factor 1 beta 2

Background

This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EEF1B2 Antibody (H00001933-M10)(1)

Publication using H00001933-M10

• Veremieva M, Kapustian L, Khoruzhenko A et al. Independent overexpression of the subunits of translation elongation factor complex eEF1H in human lung cancer. BMC Cancer. 2014-12-03 [PMID: 25472873]

Bioinformatics

• Gene Symbol: EEF1B2
• Entrez:
  • 1933(Human)
• Uniprot:
  • NP_001950.1(Human)