EEF1A2 Recombinant Protein Antigen

Images

 
There are currently no images for EEF1A2 Protein (NBP2-33280PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EEF1A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EEF1A2.

Source: E. coli

Amino Acid Sequence: LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EEF1A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33280.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EEF1A2 Recombinant Protein Antigen

  • eEF1A-2
  • EEF1ALFLJ41696
  • EF1A
  • EF-1-alpha-2
  • elongation factor 1-alpha 2
  • elongation factor-1 alpha
  • Eukaryotic elongation factor 1 A-2
  • eukaryotic translation elongation factor 1 alpha 2
  • HS1
  • statin S1
  • statin
  • statin-like
  • statin-S1
  • STN
  • STNL

Background

EEF1A2 encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00023263-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-92880
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81858
Species: Hu
Applications: IHC, IHC-P, WB
H00003059-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, PLA, S-ELISA, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82257
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-574
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-25151
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP1-59677
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90046
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-02554
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
NBP2-15895
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-33280PEP
Species: Hu
Applications: AC

Publications for EEF1A2 Protein (NBP2-33280PEP) (0)

There are no publications for EEF1A2 Protein (NBP2-33280PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEF1A2 Protein (NBP2-33280PEP) (0)

There are no reviews for EEF1A2 Protein (NBP2-33280PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EEF1A2 Protein (NBP2-33280PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EEF1A2 Products

Research Areas for EEF1A2 Protein (NBP2-33280PEP)

Find related products by research area.

Blogs on EEF1A2

There are no specific blogs for EEF1A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EEF1A2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EEF1A2