EDR1/PHC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EDR1/PHC1 Antibody [NBP1-84009] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: EDR1/PHC1 Antibody [NBP1-84009] - Staining of human pancreas shows strong nuclear positivity in islet cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EDR1/PHC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAVRNQQASAQGPQMQGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EDR1/PHC1 Protein (NBP1-84009PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EDR1/PHC1 Antibody

  • early development regulator 1 (homolog of polyhomeotic 1)
  • Early development regulatory protein 1
  • EDR1
  • HPH1
  • PH1
  • polyhomeotic homolog 1 (Drosophila)
  • polyhomeotic-like 1 (Drosophila)
  • polyhomeotic-like 1
  • polyhomeotic-like protein 1
  • RAE28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-91979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03348
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84896
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF6394
Species: Hu
Applications: WB, IP
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB100-139
Species: Hu, Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84009
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for EDR1/PHC1 Antibody (NBP1-84009) (0)

There are no publications for EDR1/PHC1 Antibody (NBP1-84009).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDR1/PHC1 Antibody (NBP1-84009) (0)

There are no reviews for EDR1/PHC1 Antibody (NBP1-84009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EDR1/PHC1 Antibody (NBP1-84009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EDR1/PHC1 Products

Bioinformatics Tool for EDR1/PHC1 Antibody (NBP1-84009)

Discover related pathways, diseases and genes to EDR1/PHC1 Antibody (NBP1-84009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDR1/PHC1 Antibody (NBP1-84009)

Discover more about diseases related to EDR1/PHC1 Antibody (NBP1-84009).
 

Pathways for EDR1/PHC1 Antibody (NBP1-84009)

View related products by pathway.

PTMs for EDR1/PHC1 Antibody (NBP1-84009)

Learn more about PTMs related to EDR1/PHC1 Antibody (NBP1-84009).
 

Research Areas for EDR1/PHC1 Antibody (NBP1-84009)

Find related products by research area.

Blogs on EDR1/PHC1

There are no specific blogs for EDR1/PHC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EDR1/PHC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHC1