EDR1/PHC1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EDR1/PHC1 Antibody [NBP1-84009] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.

Immunohistochemistry-Paraffin: EDR1/PHC1 Antibody [NBP1-84009] - Staining of human pancreas shows strong nuclear positivity in islet cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EDR1/PHC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EDR1/PHC1 Antibody - BSA Free (NBP1-84009) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAVRNQQASAQGPQMQGS
• Predicted Species: Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EDR1/PHC1 Protein (NBP1-84009PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EDR1/PHC1 Antibody - BSA Free

• early development regulator 1 (homolog of polyhomeotic 1)
• Early development regulatory protein 1
• EDR1
• HPH1
• PH1
• polyhomeotic homolog 1 (Drosophila)
• polyhomeotic-like 1 (Drosophila)
• polyhomeotic-like 1
• polyhomeotic-like protein 1
• RAE28

Background

EDR1 / PHC1 is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHC1