EDNRA/Endothelin R Type A Antibody (2A5) Summary
Immunogen |
EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK |
Specificity |
EDNRA - endothelin receptor type A (2A5) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
EDNRA |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Sandwich ELISA 1:100-1:2000
|
Application Notes |
Antibody reactivity against recombinant protein for WB. It has been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for EDNRA/Endothelin R Type A Antibody (2A5)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)
There are no publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)
There are no reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional EDNRA/Endothelin R Type A Products
Bioinformatics Tool for EDNRA/Endothelin R Type A Antibody (H00001909-M02)
Discover related pathways, diseases and genes to EDNRA/Endothelin R Type A Antibody (H00001909-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for EDNRA/Endothelin R Type A Antibody (H00001909-M02)
Discover more about diseases related to EDNRA/Endothelin R Type A Antibody (H00001909-M02).
| | Pathways for EDNRA/Endothelin R Type A Antibody (H00001909-M02)
View related products by pathway.
|
PTMs for EDNRA/Endothelin R Type A Antibody (H00001909-M02)
Learn more about PTMs related to EDNRA/Endothelin R Type A Antibody (H00001909-M02).
| | Research Areas for EDNRA/Endothelin R Type A Antibody (H00001909-M02)
Find related products by research area.
|
Blogs on EDNRA/Endothelin R Type A