EDNRA/Endothelin R Type A Antibody (2A5)


Western Blot: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Analysis of EDNRA expression in transfected 293T cell line by EDNRA monoclonal antibody (M02), clone 2A5.Lane 1: EDNRA transfected lysate(48.7 ...read more
Sandwich ELISA: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Detection limit for recombinant GST tagged EDNRA is approximately 0.1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA

Order Details

EDNRA/Endothelin R Type A Antibody (2A5) Summary

EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
EDNRA - endothelin receptor type A (2A5)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EDNRA/Endothelin R Type A Antibody (2A5)

  • endothelin receptor type A
  • endothelin-1 receptor
  • endothelin-1-specific receptor
  • ET1-specific type
  • ETAR
  • ETRA
  • G protein-coupled receptor
  • hET-AR


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, IHC, IP, ICFlow, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EDNRA/Endothelin R Type A Products

Bioinformatics Tool for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Discover related pathways, diseases and genes to EDNRA/Endothelin R Type A Antibody (H00001909-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Discover more about diseases related to EDNRA/Endothelin R Type A Antibody (H00001909-M02).

Pathways for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

View related products by pathway.

PTMs for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Learn more about PTMs related to EDNRA/Endothelin R Type A Antibody (H00001909-M02).

Research Areas for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Find related products by research area.

Blogs on EDNRA/Endothelin R Type A

There are no specific blogs for EDNRA/Endothelin R Type A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EDNRA/Endothelin R Type A Antibody (2A5) and receive a gift card or discount.


Gene Symbol EDNRA