Home » EDNRA/Endothelin R Type A » EDNRA/Endothelin R Type A Antibodies » EDNRA/Endothelin R Type A Antibody (2A5)

EDNRA/Endothelin R Type A Antibody (2A5)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Analysis of EDNRA expression in transfected 293T cell line by EDNRA monoclonal antibody (M02), clone 2A5.Lane 1: EDNRA transfected lysate(48.7 KDa).Lane 2: Non-transfected lysate.
Western Blot: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Analysis of EDNRA expression in transfected 293T cell line by EDNRA monoclonal antibody (M02), clone 2A5.Lane 1: EDNRA transfected lysate(48.7 ...read more
Sandwich ELISA: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Detection limit for recombinant GST tagged EDNRA is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

EDNRA/Endothelin R Type A Antibody (2A5) Summary

Immunogen
EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
Specificity
EDNRA - endothelin receptor type A (2A5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EDNRA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EDNRA/Endothelin R Type A Antibody (2A5)

  • EDNRA
  • endothelin receptor type A
  • endothelin-1 receptor
  • endothelin-1-specific receptor
  • ET1-specific type
  • ETAR
  • ETRA
  • G protein-coupled receptor
  • hET-AR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

EDNRB/Endothelin R
Type B Antibody - BSA ...
NLS54
Immunohistochemistry-Paraffin: EDNRB/Endothelin R Type B Antibody [NLS54] - Brain, Dementia, Senile Plaque
Immunohistochemistry-Paraffin: EDNRB/Endothelin R Type B Antibody [NLS54] - Artery, smooth muscle
Immunohistochemistry-Paraffin: EDNRB/Endothelin R Type B Antibody [NLS54] - Brain, Alzheimer's senile plaque
(2 Publications)
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Endothelin-1 [HRP]
QET00B
(3 Reviews)
(40 Publications)
Species: Hu
Applications: ELISA
Endothelin-3
Antibody (3B6) [Uncon ...
MAB5579
Endothelin‑3 was detected in immersion fixed LNCaP human prostate cancer cell line using Mouse Anti-Human Endothelin‑3 Monoclonal Antibody (Catalog # MAB5579) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell secretion. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC
Endothelin 2
Antibody
NBP1-87942
Western Blot: Endothelin 2 Antibody [NBP1-87942] - Analysis in control (vector only transfected HEK293T lysate) and EDN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Endothelin 2 Antibody [NBP1-87942] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Endothelin 2 Antibody [NBP1-87942] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in mouse kidney using DAB with hematoxylin counterstain.
Western Blot: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in human kidney lysate.
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody - BSA Free [NBP1-30027] - Analysis of a FFPE tissue section of human placenta using 1:200 dilution of Serpin A8 (NBP1-30027) antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(718 Publications)
Species: Hu
Applications: BA
ECE-1 Antibody
AF1784
ECE‑1 was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human ECE‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1784) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the endothelial cells in glomeruli. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
MCF‑7 human breast cancer cell line was stained with Human ECE‑1 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF1784, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(8 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, IP, ICFlow, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Western Blot: iNOS Antibody [NB300-605] - LCA-induced oxidative stress in 4T1 breast cancer cells. The 4T1 cells were treated with LCA for 48 h, then the indicated measurements were performed. The level of iNOS protein was detected by western blotting (n = 3). Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2072-6694/11/9/1255), licensed under a CC-BY licence.
Western Blot: iNOS Antibody [NB300-605] - iNOS in stimulated astrocytes. Western blot image submitted by a verified customer review.
(3 Reviews)
(84 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
VEGF [HRP]
DVE00
(26 Reviews)
(600 Publications)
Species: Hu
Applications: ELISA
eNOS Antibody -
BSA Free
NB300-500
Immunohistochemistry: eNOS Antibody [NB300-500] - Staining of representative pulmonary artery endothelial cells from rats subjected to CON=Control Group, ALI=Acute lung injury Group, LV=Low tidal volume Group, VLV=Very low tidal volume Group, MV=Large tidal volume Group. Dark brown staining of indicates eNOS-positive cells. Magnification x400.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Expression of endothelial markers indicate functional endothelium in TEVG. Whole mount staining of native aorta and TEVG. VE-cadherin is a marker of cellular borders of endothelial cells (green). Endothelial nitric oxide synthase (eNOS) is a marker of a functional endothelium (red). DAPI is a nuclear stain (blue). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120328), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
(3 Reviews)
(20 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Band 3 Antibody
NBP2-49409
Immunohistochemistry: Band 3 Antibody [NBP2-49409] - Staining of human spleen shows strong positivity in erythrocytes.
Immunohistochemistry-Paraffin: Band 3 Antibody [NBP2-49409] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Band 3 Antibody [NBP2-49409] - Staining in human bone marrow and cerebral cortex tissues using anti-SLC4A1 antibody. Corresponding SLC4A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Biliverdin
Reductase B/BLVRB Ant
NBP1-83435
Western Blot: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human colon, liver, small intestine and spleen using Anti-BLVRB antibody NBP1-83435 (A) shows similar protein distribution across tissues to independent antibody NBP1-83434 (B).
Western Blot: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Analysis using Anti-BLVRB antibody NBP1-83435 (A) shows similar pattern to independent antibody NBP1-83434 (B).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Angiogenin [HRP]
DAN00
(21 Publications)
Species: Hu
Applications: ELISA
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EDNRA/Endothelin R Type A Products

Bioinformatics Tool for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Discover related pathways, diseases and genes to EDNRA/Endothelin R Type A Antibody (H00001909-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Discover more about diseases related to EDNRA/Endothelin R Type A Antibody (H00001909-M02).
 

Pathways for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

View related products by pathway.

PTMs for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Learn more about PTMs related to EDNRA/Endothelin R Type A Antibody (H00001909-M02).
 

Research Areas for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Find related products by research area.

Blogs on EDNRA/Endothelin R Type A

There are no specific blogs for EDNRA/Endothelin R Type A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EDNRA/Endothelin R Type A Antibody (2A5) and receive a gift card or discount.


Bioinformatics

Gene Symbol EDNRA
Entrez
Uniprot