EDNRA/Endothelin R Type A Antibody (2A5)

Western Blot: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Analysis of EDNRA expression in transfected 293T cell line by EDNRA monoclonal antibody (M02), clone 2A5.Lane 1: EDNRA transfected lysate(48.7 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Detection limit for recombinant GST tagged EDNRA is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2A5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

EDNRA/Endothelin R Type A Antibody (2A5) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
• Specificity: EDNRA - endothelin receptor type A (2A5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EDNRA
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EDNRA/Endothelin R Type A Antibody (2A5)

• EDNRA
• endothelin receptor type A
• endothelin-1 receptor
• endothelin-1-specific receptor
• ET1-specific type
• ETAR
• ETRA
• G protein-coupled receptor
• hET-AR

Background

Endothelins are a family of peptides that are potent vasoconstrictors produced by mammalian vascular endothelial cells. The receptors for endothelins are widely expressed on tissues. This sheep antibody recognizes epitopes on the cytoplasmic region of the ET(A) Receptor. The binding of this antibody does not interfere with the function of the receptor so that endothelins can interact with the receptor while the antibody is present.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EDNRA
• Entrez:
  • 1909(Human)
• Uniprot:
  • AAH22511()