Home » EDNRA/Endothelin R Type A » EDNRA/Endothelin R Type A Antibodies » EDNRA/Endothelin R Type A Antibody (2A5)

EDNRA/Endothelin R Type A Antibody (2A5)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Analysis of EDNRA expression in transfected 293T cell line by EDNRA monoclonal antibody (M02), clone 2A5.Lane 1: EDNRA transfected lysate(48.7 KDa).Lane 2: Non-transfected lysate.
Western Blot: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Analysis of EDNRA expression in transfected 293T cell line by EDNRA monoclonal antibody (M02), clone 2A5.Lane 1: EDNRA transfected lysate(48.7 ...read more
Sandwich ELISA: EDNRA/Endothelin R Type A Antibody (2A5) [H00001909-M02] - Detection limit for recombinant GST tagged EDNRA is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

EDNRA/Endothelin R Type A Antibody (2A5) Summary

Immunogen
EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
Specificity
EDNRA - endothelin receptor type A (2A5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EDNRA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA 1:100-1:2000
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EDNRA/Endothelin R Type A Antibody (2A5)

  • EDNRA
  • endothelin receptor type A
  • endothelin-1 receptor
  • endothelin-1-specific receptor
  • ET1-specific type
  • ETAR
  • ETRA
  • G protein-coupled receptor
  • hET-AR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

EDNRB/Endothelin R
Type B Antibody
NLS54
Immunocytochemistry/Immunofluorescence: EDNRB/Endothelin R Type B Antibody [NLS54] - Analysis of anti-EDNRB / Endothelin B Receptor antibody with transfected cells expressing Endothelin B Receptor at 4 ug/ ml.
Immunohistochemistry-Paraffin: EDNRB/Endothelin R Type B Antibody [NLS54] - Brain, Alzheimer's senile plaque
Immunocytochemistry/Immunofluorescence: EDNRB/Endothelin R Type B Antibody [NLS54] - Analysis of anti-EDNRB / Endothelin B Receptor antibody with cells expressing vector only using this antibody at 4 ug/ ml.
(2 Publications)
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
Endothelin-1 [HRP]
QET00B
(3 Reviews)
(35 Publications)
Species: Hu
Endothelin-3
Antibody (2A6-2A4)
H00001908-M01
Western Blot: Endothelin-3 Antibody (2A6-2A4) [H00001908-M01] - Analysis of EDN3 expression in transfected 293T cell line by EDN3 monoclonal antibody (M01), clone 2A6-2A4.Lane 1: EDN3 transfected lysate(25.5 KDa).Lane 2: Non-transfected lysate.
Western Blot: Endothelin-3 Antibody (2A6-2A4) [H00001908-M01] - EDN3 monoclonal antibody (M01), clone 2A6-2A4 Analysis of EDN3 expression in LNCaP.
Immunoprecipitation: Endothelin-3 Antibody (2A6-2A4) [H00001908-M01] - Analysis of EDN3 transfected lysate using anti-EDN3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EDN3 MaxPab rabbit polyclonal antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
Endothelin 2
Antibody
NBP1-87942
Western Blot: Endothelin 2 Antibody [NBP1-87942] - Analysis in control (vector only transfected HEK293T lysate) and EDN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Endothelin 2 Antibody [NBP1-87942] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Endothelin 2 Antibody [NBP1-87942] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. Western blot analysis for protein expressions of intrarenal RAS components in the two groups of mice. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Immunohistochemistry: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. (A) Immunohistochemical analysis of intrarenal RAS expression position in the two groups of mice. AGT immunoreactivity in the proximal tubular cells, Ang II immunoreactivity in both glomerular and tubular cells, renin immunoreactivity in juxtaglomerular apparatus cells, ACE immunoreactivity in brush border membranes of proximal tubules as well as AT1 and AT2 immunoreactivity in the proximal tubules were increased in the HF group when compared to the control group. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
ECE-1 Antibody
AF1784
ECE‑1 was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human ECE‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1784) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the endothelial cells in glomeruli. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
MCF‑7 human breast cancer cell line was stained with Human ECE‑1 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF1784, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(7 Publications)
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICFlow
iNOS Antibody
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Immunohistochemistry-Paraffin: iNOS Antibody [NB300-605] - Immunohistochemistry was performed on normal deparaffinized human Lung tissue.
Immunohistochemistry-Paraffin: iNOS Antibody [NB300-605] - Immunohistochemistry was performed on normal deparaffinized human Heart tissue.
(3 Reviews)
(56 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
PRRT2 Antibody
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
VEGF [HRP]
DVE00
(26 Reviews)
(514 Publications)
Species: Hu
eNOS Antibody
NB300-500
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Expression of endothelial markers indicate functional endothelium in TEVG. Whole mount staining of native aorta and TEVG. VE-cadherin is a marker of cellular borders of endothelial cells (green). Endothelial nitric oxide synthase (eNOS) is a marker of a functional endothelium (red). DAPI is a nuclear stain (blue). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120328), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Mouse Carotid Artery stained with eNOS antibody. Image from verified customer review.
(3 Reviews)
(17 Publications)
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Band 3 Antibody
(BIII 136)
NB120-11012
Western Blot: Band 3 Antibody (BIII 136) [NB120-11012] - Human erythrocytes ghosts extract was separated on SDS-PAGE and probed with Monoclonal Anti-Band 3 Clone: BIII-136. The antibody was developed using Goat Anti-Mouse IgG-Peroxidase and AEC substrate.
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
Biliverdin
Reductase B/BLVRB Ant
NBP1-83435
Western Blot: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Analysis using Anti-BLVRB antibody NBP1-83435 (A) shows similar pattern to independent antibody NBP1-83434 (B).
Immunocytochemistry/Immunofluorescence: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Angiogenin [HRP]
DAN00
(20 Publications)
Species: Hu
SGSM3 Antibody
NBP2-13304
Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no publications for EDNRA/Endothelin R Type A Antibody (H00001909-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no reviews for EDNRA/Endothelin R Type A Antibody (H00001909-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EDNRA/Endothelin R Type A Antibody (H00001909-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional EDNRA/Endothelin R Type A Products

Bioinformatics Tool for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Discover related pathways, diseases and genes to EDNRA/Endothelin R Type A Antibody (H00001909-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Discover more about diseases related to EDNRA/Endothelin R Type A Antibody (H00001909-M02).
 

Pathways for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

View related products by pathway.

PTMs for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Learn more about PTMs related to EDNRA/Endothelin R Type A Antibody (H00001909-M02).
 

Research Areas for EDNRA/Endothelin R Type A Antibody (H00001909-M02)

Find related products by research area.

Blogs on EDNRA/Endothelin R Type A

There are no specific blogs for EDNRA/Endothelin R Type A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EDNRA/Endothelin R Type A Antibody (2A5) and receive a gift card or discount.


Bioinformatics

Gene Symbol EDNRA
Entrez
Uniprot