EBP Recombinant Protein Antigen

Images

 
There are currently no images for EBP Protein (NBP1-85699PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EBP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EBP.

Source: E. coli

Amino Acid Sequence: YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EBP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85699.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EBP Recombinant Protein Antigen

  • 3-beta-hydroxysteroid-Delta(8)
  • CDPX2
  • Cholestenol Delta-isomerase
  • CPX3-beta-hydroxysteroid-delta-8
  • CPXDX-linked dominant (Happle syndrome)
  • D8-D7 sterol isomerase
  • Delta(7)-isomerase
  • Delta(8)-Delta(7) sterol isomerase
  • delta-7-isomerase
  • EBP
  • EC 5.3.3.5
  • emopamil binding protein (sterol isomerase)
  • Emopamil-binding protein
  • sterol 8-isomerase

Background

The protein encoded by the EBP gene is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist (3H)emopamil and the photoaffinity label (3H)azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of this protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
M6000B
Species: Mu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-46179
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
3047-CC
Species: Hu
Applications: BA
DPSG10
Species: Hu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for EBP Protein (NBP1-85699PEP) (0)

There are no publications for EBP Protein (NBP1-85699PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EBP Protein (NBP1-85699PEP) (0)

There are no reviews for EBP Protein (NBP1-85699PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EBP Protein (NBP1-85699PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EBP Products

Array NBP1-85699PEP

Research Areas for EBP Protein (NBP1-85699PEP)

Find related products by research area.

Blogs on EBP

There are no specific blogs for EBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EBP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EBP