Recombinant Human E2F7 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human E2F7 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 801-910 of Human E2F7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VVNPKSSTLPSADPQLQSQPSLNLSPVMSRSHSVVQQPESPVYVGHPVSVVKLHQSPVPVTPKSIQRTHRETFFKTPGSLGDPVLKRRERNQSRNTSSAQRRLEIPSGGA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
E2F7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human E2F7 GST (N-Term) Protein

  • E2F transcription factor 7
  • E2F-7
  • FLJ12981
  • transcription factor E2F7

Background

E2F transcription factors, such as E2F7, play an essential role in the regulation of cell cycle progression (Di Stefano et al., 2003 [PubMed 14633988]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67899
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00079733-M01
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC
AF5119
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-21374
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00005729-B01P
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-80295
Species: Hu
Applications: WB
H00001876-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
H00000894-B01P
Species: Hu, Rt
Applications: WB
NBP2-49158
Species: Hu
Applications: IHC, IHC-P
NB100-317
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-28632
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-31376
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NBP2-45788
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for E2F7 Partial Recombinant Protein (H00144455-Q01) (0)

There are no publications for E2F7 Partial Recombinant Protein (H00144455-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E2F7 Partial Recombinant Protein (H00144455-Q01) (0)

There are no reviews for E2F7 Partial Recombinant Protein (H00144455-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for E2F7 Partial Recombinant Protein (H00144455-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional E2F7 Products

Array H00144455-Q01

Bioinformatics Tool for E2F7 Partial Recombinant Protein (H00144455-Q01)

Discover related pathways, diseases and genes to E2F7 Partial Recombinant Protein (H00144455-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E2F7 Partial Recombinant Protein (H00144455-Q01)

Discover more about diseases related to E2F7 Partial Recombinant Protein (H00144455-Q01).
 

Pathways for E2F7 Partial Recombinant Protein (H00144455-Q01)

View related products by pathway.

Blogs on E2F7

There are no specific blogs for E2F7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human E2F7 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol E2F7