Recombinant Human E2F7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human E2F7 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 801 - 910 of Human E2F7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VVNPKSSTLPSADPQLQSQPSLNLSPVMSRSHSVVQQPESPVYVGHPVSVVKLHQSPVPVTPKSIQRTHRETFFKTPGSLGDPVLKRRERNQSRNTSSAQRRLEIPSGGA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
E2F7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human E2F7 Protein

  • E2F transcription factor 7
  • E2F-7
  • FLJ12981
  • transcription factor E2F7

Background

E2F transcription factors, such as E2F7, play an essential role in the regulation of cell cycle progression (Di Stefano et al., 2003 [PubMed 14633988]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00079733-M01
Species: Hu
Applications: WB, ELISA
AF5119
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-80295
Species: Hu
Applications: WB
H00001876-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-28632
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00144455-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for E2F7 Partial Recombinant Protein (H00144455-Q01) (0)

There are no publications for E2F7 Partial Recombinant Protein (H00144455-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E2F7 Partial Recombinant Protein (H00144455-Q01) (0)

There are no reviews for E2F7 Partial Recombinant Protein (H00144455-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for E2F7 Partial Recombinant Protein (H00144455-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional E2F7 Products

Bioinformatics Tool for E2F7 Partial Recombinant Protein (H00144455-Q01)

Discover related pathways, diseases and genes to E2F7 Partial Recombinant Protein (H00144455-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E2F7 Partial Recombinant Protein (H00144455-Q01)

Discover more about diseases related to E2F7 Partial Recombinant Protein (H00144455-Q01).
 

Pathways for E2F7 Partial Recombinant Protein (H00144455-Q01)

View related products by pathway.

Blogs on E2F7

There are no specific blogs for E2F7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

E2F7 Antibody
NBP1-52649

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human E2F7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol E2F7