E2F5 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit E2F5 Antibody - BSA Free (NBP2-56500) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: INLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSLTPVTPQKSSMATQNL |
| Predicted Species |
Mouse (93%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
E2F5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for E2F5 Antibody - BSA Free
Background
The protein encoded by the E2F5 gene is a member of the E2F family of transcription factors. The E2F family plays a crucialrole in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transformingproteins of small DNA tumor viruses. The E2F proteins contain several evolutionarily conserved domains that arepresent in most members of the family. These domains include a DNA binding domain, a dimerization domain whichdetermines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domainenriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within thetransactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of humantissues. It has higher identity to E2F4 than to other family members. Both this protein and E2F4 interact with tumorsuppressor proteins p130 and p107, but not with pRB. Alternative splicing results in multiple variants encodingdifferent isoforms. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Publications for E2F5 Antibody (NBP2-56500) (0)
There are no publications for E2F5 Antibody (NBP2-56500).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for E2F5 Antibody (NBP2-56500) (0)
There are no reviews for E2F5 Antibody (NBP2-56500).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for E2F5 Antibody (NBP2-56500) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional E2F5 Products
Research Areas for E2F5 Antibody (NBP2-56500)
Find related products by research area.
|
Blogs on E2F5