DZIP1 Antibody

Images

 
Immunohistochemistry: DZIP1 Antibody [NBP2-31587] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DZIP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DZIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DZIP1 Protein (NBP2-31587PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DZIP1 Antibody

  • DAZ interacting protein 1
  • DAZ-interacting protein 1/2
  • DZIP
  • DZIP2
  • DZIPDAZ interacting protein testis1
  • DZIPt1
  • KIAA0996zinc finger DAZ interacting protein 1
  • RP11-23E3.3
  • zinc finger protein DZIP1
  • zinc-finger protein DZIPt1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
1705-HH/CF
Species: Hu, Mu
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-92056
Species: Hu
Applications: IHC, IHC-P
AF196
Species: Mu
Applications: WB, IHC
NB200-119
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for DZIP1 Antibody (NBP2-31587) (0)

There are no publications for DZIP1 Antibody (NBP2-31587).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DZIP1 Antibody (NBP2-31587) (0)

There are no reviews for DZIP1 Antibody (NBP2-31587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DZIP1 Antibody (NBP2-31587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DZIP1 Products

Bioinformatics Tool for DZIP1 Antibody (NBP2-31587)

Discover related pathways, diseases and genes to DZIP1 Antibody (NBP2-31587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DZIP1 Antibody (NBP2-31587)

Discover more about diseases related to DZIP1 Antibody (NBP2-31587).
 

Pathways for DZIP1 Antibody (NBP2-31587)

View related products by pathway.

PTMs for DZIP1 Antibody (NBP2-31587)

Learn more about PTMs related to DZIP1 Antibody (NBP2-31587).

Blogs on DZIP1

There are no specific blogs for DZIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DZIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DZIP1
Uniprot