Recombinant Human Dyrk1B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Dyrk1B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 479-569 of Human DYRK1B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DYRK1B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dyrk1B Protein

  • dual specificity tyrosine-phosphorylation-regulated kinase 1B
  • dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
  • EC 2.7.12
  • Minibrain-related kinase
  • Mirk protein kinase
  • MIRKEC 2.7.12.1

Background

DYRK1B - dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-15141
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92589
Species: Hu, Dr
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15087
Species: Hu, Mu
Applications: WB
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB110-94452
Species: Hu, Ch, Mu(-), Rt(-)
Applications: WB, ICC/IF
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00009149-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Dyrk1B Partial Recombinant Protein (H00009149-Q01) (0)

There are no publications for Dyrk1B Partial Recombinant Protein (H00009149-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dyrk1B Partial Recombinant Protein (H00009149-Q01) (0)

There are no reviews for Dyrk1B Partial Recombinant Protein (H00009149-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dyrk1B Partial Recombinant Protein (H00009149-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dyrk1B Products

Bioinformatics Tool for Dyrk1B Partial Recombinant Protein (H00009149-Q01)

Discover related pathways, diseases and genes to Dyrk1B Partial Recombinant Protein (H00009149-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dyrk1B Partial Recombinant Protein (H00009149-Q01)

Discover more about diseases related to Dyrk1B Partial Recombinant Protein (H00009149-Q01).
 

Pathways for Dyrk1B Partial Recombinant Protein (H00009149-Q01)

View related products by pathway.

PTMs for Dyrk1B Partial Recombinant Protein (H00009149-Q01)

Learn more about PTMs related to Dyrk1B Partial Recombinant Protein (H00009149-Q01).
 

Research Areas for Dyrk1B Partial Recombinant Protein (H00009149-Q01)

Find related products by research area.

Blogs on Dyrk1B

There are no specific blogs for Dyrk1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Dyrk1B Antibody
NBP1-33464

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dyrk1B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DYRK1B