DYNC1LI1 Antibody

Images

 
Western Blot: DYNC1LI1 Antibody [NBP2-87315] - WB Suggested Anti-DYNC1LI1 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DYNC1LI1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DYNC1LI1. Peptide sequence: AEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DYNC1LI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DYNC1LI1 Antibody

  • cytoplasmic dynein 1 light intermediate chain 1
  • DNCLI1
  • dynein, cytoplasmic 1, light intermediate chain 1
  • LIC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16056
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-88861
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
NBP2-85249
Species: Hu, Mu
Applications: WB
NBP3-17099
Species: Hu
Applications: IHC, IHC-P
NBP2-00714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-21395
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92136
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NB300-726
Species: Dr, Hu, Ma, Mu, Rt, Xp
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-38469
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB120-5802
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-88795
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-52721
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-87315
Species: Hu
Applications: WB

Publications for DYNC1LI1 Antibody (NBP2-87315) (0)

There are no publications for DYNC1LI1 Antibody (NBP2-87315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYNC1LI1 Antibody (NBP2-87315) (0)

There are no reviews for DYNC1LI1 Antibody (NBP2-87315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DYNC1LI1 Antibody (NBP2-87315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DYNC1LI1 Products

Bioinformatics Tool for DYNC1LI1 Antibody (NBP2-87315)

Discover related pathways, diseases and genes to DYNC1LI1 Antibody (NBP2-87315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYNC1LI1 Antibody (NBP2-87315)

Discover more about diseases related to DYNC1LI1 Antibody (NBP2-87315).
 

Pathways for DYNC1LI1 Antibody (NBP2-87315)

View related products by pathway.

PTMs for DYNC1LI1 Antibody (NBP2-87315)

Learn more about PTMs related to DYNC1LI1 Antibody (NBP2-87315).

Blogs on DYNC1LI1

There are no specific blogs for DYNC1LI1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DYNC1LI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DYNC1LI1