Home » dUTPase » dUTPase Proteins » dUTPase Recombinant Protein Antigen

dUTPase Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for dUTPase Protein (NBP2-47479PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

dUTPase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DUT.

Source: E.coli

Amino Acid Sequence: ETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPR
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DUT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47479.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for dUTPase Recombinant Protein Antigen

  • deoxyuridine triphosphatase
  • dUTP pyrophosphatasedUTP nucleotidohydrolase
  • dUTPasedeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
  • EC 3.6.1.23
  • FLJ20622

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Thymidylate
Synthase Antibody (SP
NBP2-34390
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - Formalin-fixed, paraffin-embedded human Testicular Carcinoma stained with Thymidylate Synthase Antibody (SPM453).
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on Hek293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the PE format of this antibody.
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on HEK293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the Azide and BSA Free format of this antibody.
(1 Review)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
UNG Antibody
NB600-1031
Western Blot: UNG Antibody [NB600-1031] - Total protein from human HeLa cells, muse Neuro2A cells and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-UNG in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: uracil-DNA glycosylase Antibody [NB600-1031] - Analysis of human testis using this antibody at 10 ug/ml.
(4 Publications)
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Thromboxane
synthase Antibody (OT
NBP2-02710
Western Blot: Thromboxane synthase Antibody (2C1) [NBP2-02710] Analysis of extracts (35ug) from 9 different cell lines by using anti-Thromboxane synthase monoclonal antibody.
Immunocytochemistry/Immunofluorescence: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Thromboxane synthase.
Immunohistochemistry-Paraffin: Thromboxane synthase Antibody (2C1) [NBP2-02710] - Staining of paraffin-embedded Human liver tissue using anti-Thromboxane synthase mouse monoclonal antibody.
(1 Publication)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Cav1.2 Antibody
NBP2-76914
Immunocytochemistry/Immunofluorescence: Cav1.2 Antibody [NBP2-76914] - ICC staining CACNA1C in SKOV-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: Cav1.2 Antibody [NBP2-76914] - Immunohistochemical analysis of paraffin-embedded mouse heart tissue using anti-CACNA1C antibody. Counter stained with hematoxylin.
Flow Cytometry: Cav1.2 Antibody [NBP2-76914] - Flow cytometric analysis of SKOV-3 cells with CACNA1C antibody at 1/100 dilution (fuchsia) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining in human adrenal gland and liver tissues using anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues.
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Dihydrofolate
Reductase/DHFR Antibo ...
H00001719-M01
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Folic acid treatment restores endothelial specific DHFR expression and activity in Ang II-infused apoE null mice.DHFR expression (A, n?=?8-11) and activity (B, n?=?5-7) measured from endothelial cells (ECs) and EC-denuded aortas isolated from apoE null mice after 4 weeks of infusion. Data show that DHFR expression and activity was restored in FA treated animals specifically in the endothelial cells. eNOS was stained to show that isolation/removal of ECs from the vessels was successful. *p<0.05. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0088899) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of monoclonal antibody to DHFR on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - DHFR monoclonal antibody (M01), clone 2B10 Analysis of DHFR expression in HeLa.
(13 Publications)
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
CRAT Antibody
NBP1-86615
Western Blot: CRAT Antibody [NBP1-86615] - Analysis using Anti-CRAT antibody NBP1-86615 (A) shows similar pattern to independent antibody NBP1-86616 (B).
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human tonsil shows low expression as expected.
Western Blot: CRAT Antibody [NBP1-86615] - Staining in human testis and tonsil tissues using anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, IHC, IHC-P
Deoxycytidylate
deaminase Antibody
NBP1-87424
Western Blot: Deoxycytidylate deaminase Antibody [NBP1-87424] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-160
Immunocytochemistry/Immunofluorescence: Deoxycytidylate deaminase Antibody [NBP1-87424] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Deoxycytidylate deaminase Antibody [NBP1-87424] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PD-ECGF/Thymidine
Phosphorylase Antibod ...
NB100-2737
Immunohistochemistry: PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) [NB100-2737] - Immunohistochemical staining of thymidine phosphorylase (TP) expression and related markers in benign lymph node. In benign lymph node, TP expression highlights the meshwork of macrophages (arrow in inset; 400x) and endothelial cells (arrowhead in inset; 400x). Images are from an Olympus BX41 microscope (Olympus Corp., Tokyo, Japan) processed with Qcapture Pro 5.1 (QImaging, Surrey, BC, Canada). Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/ah/2011/875135/) licensed under a CC-BY licence.
Immunohistochemistry: PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) [NB100-2737] - Immunohistochemical staining of thymidine phosphorylase (TP) expression and related markers in benign lymph node in lymph node with malignant mycosis fungoides/Sezary syndrome cells (LN-MF). CD21 is negative in this case of LN-MF. Images are from an Olympus BX41 microscope (Olympus Corp., Tokyo, Japan) processed with Qcapture Pro 5.1 (QImaging, Surrey, BC, Canada). Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/ah/2011/875135/) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) [NB100-2737] - Analysis of Thymidine Phosphorylase formalin-fixed paraffin embedded human breast carcinoma.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Rad51 Antibody
(14B4)
NB100-148
Western Blot: Rad51 Antibody (14B4) [NB100-148] - eIF3f facilitates hMSH4 stabilization. Western blotting analysis of the levels of HDAC3, hRad51, and VBP1 expression in 293T, 293T/eIF3f, and 293T/eIF3f-hMSH4 cells. 293T/eIF3f-hMSH4 cells treated with 1 or 10 Gy IR were fractionated at 6 hrs post-treatment and the levels of hMSH4 and eIF3f in the nuclear and cytoplasmic fractions were determined by immunoblotting. Alpha-tubulin was used as a marker for the cytoplasmic fraction. Image collected and cropped by CiteAb from the following publication (https://molecular-cancer.biomedcentral.com/articles/10.1186/1476-4598-12-51) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Rad51 Antibody (14B4) [NB100-148] - Staining of RAD51 nuclear foci in U2OS cells using RAD51 14B4 antibody. Cells were pre-extracted with CSK buffer before fixation with 4% PFA. RAD51 14B4 was used at 1:1000 dultion. DAPI was used to counterstain the nucleus. Scale bar, 10 mciro-meter.
Immunohistochemistry-Paraffin: Rad51 Antibody (14B4) [NB100-148] - BT483 xenograft. RAD51 antibody 14B4 dilution at 1:200. Antigen Retrieval: Trilogy(TM) (EDTA based, pH 8.0) buffer, 15 min.
(4 Reviews)
(49 Publications)
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
Recombinant Human
POMT1 GST (N-Term) Pr ...
H00010585-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
IL-6 [HRP]
D6050
(25 Reviews)
(463 Publications)
Species: Hu
DTYMK Antibody
(OTI1G8)
NBP2-01184
Western Blot: DTYMK Antibody (1G8) [NBP2-01184] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DTYMK (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DTYMK.
Immunocytochemistry/Immunofluorescence: DTYMK Antibody (1G8) [NBP2-01184] Staining of COS7 cells transiently transfected by pCMV6-ENTRY DTYMK.
Immunohistochemistry-Paraffin: DTYMK Antibody (1G8) [NBP2-01184] - Staining of paraffin-embedded Human prostate tissue using anti-DTYMK mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
APE Antibody
(13B8E5C2)
NB100-116
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Knockdown Validated: APE Antibody (13B8E5C2) [NB100-116] - Repression of p21 by APE1 in p53-null cells and effect of ectopic p53 in this repression. Representative Western analysis of p53, APE1, p21 and alpha-Tubulin levels in the same HCT116p53null cells. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0068467) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells stained NB100-116 (Green) detected with DyLight Fluor 488 conjugated anti-rabbit IgG secondary antibody. Nuclei are counterstained with Hoechst 33258 (Blue).
(3 Reviews)
(93 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
dUTPase
Recombinant Protein A
NBP2-47479PEP
dUTPase Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for dUTPase Protein (NBP2-47479PEP) (0)

There are no publications for dUTPase Protein (NBP2-47479PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for dUTPase Protein (NBP2-47479PEP) (0)

There are no reviews for dUTPase Protein (NBP2-47479PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for dUTPase Protein (NBP2-47479PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional dUTPase Products

Bioinformatics Tool for dUTPase Protein (NBP2-47479PEP)

Discover related pathways, diseases and genes to dUTPase Protein (NBP2-47479PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for dUTPase Protein (NBP2-47479PEP)

Discover more about diseases related to dUTPase Protein (NBP2-47479PEP).
 

Pathways for dUTPase Protein (NBP2-47479PEP)

View related products by pathway.

PTMs for dUTPase Protein (NBP2-47479PEP)

Learn more about PTMs related to dUTPase Protein (NBP2-47479PEP).
 

Research Areas for dUTPase Protein (NBP2-47479PEP)

Find related products by research area.

Blogs on dUTPase

There are no specific blogs for dUTPase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [HRP]
IL-6 [HRP]
D6050
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
APE Antibody (13B8E5C2)
NB100-116

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our dUTPase Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DUT