dUTPase Recombinant Protein Antigen

Images

 
There are currently no images for dUTPase Protein (NBP2-33277PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

dUTPase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DUT.

Source: E. coli

Amino Acid Sequence: SGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DUT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33277.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for dUTPase Recombinant Protein Antigen

  • deoxyuridine triphosphatase
  • dUTP pyrophosphatasedUTP nucleotidohydrolase
  • dUTPasedeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
  • EC 3.6.1.23
  • FLJ20622

Background

dUTPase encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-1031
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
H00001635-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, S-ELISA, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-01184
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, PLA, Simple Western, WB
NBP2-33277PEP
Species: Hu
Applications: AC

Publications for dUTPase Protein (NBP2-33277PEP) (0)

There are no publications for dUTPase Protein (NBP2-33277PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for dUTPase Protein (NBP2-33277PEP) (0)

There are no reviews for dUTPase Protein (NBP2-33277PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for dUTPase Protein (NBP2-33277PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional dUTPase Products

Research Areas for dUTPase Protein (NBP2-33277PEP)

Find related products by research area.

Blogs on dUTPase

There are no specific blogs for dUTPase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our dUTPase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DUT