dUTPase Antibody (1C9) Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
DUT (AAH33645 68 a.a. - 164 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
| Specificity |
DUT - dUTP pyrophosphatase |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
DUT |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for IHC-P, IF and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for dUTPase Antibody (1C9)
Background
This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Publications for dUTPase Antibody (H00001854-M01)(1)
Showing Publication 1 -
1 of 1.
Reviews for dUTPase Antibody (H00001854-M01) (0)
There are no reviews for dUTPase Antibody (H00001854-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for dUTPase Antibody (H00001854-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional dUTPase Products
Research Areas for dUTPase Antibody (H00001854-M01)
Find related products by research area.
|
Blogs on dUTPase