dUTPase Antibody (1C9)

Images

 
Western Blot: dUTPase Antibody (1C9) [H00001854-M01] - Analysis of DUT expression in transfected 293T cell line by DUT monoclonal antibody (M01), clone 1C9.Lane 1: DUT transfected lysate(18 KDa).Lane 2: Non-transfected ...read more
Immunocytochemistry/ Immunofluorescence: dUTPase Antibody (1C9) [H00001854-M01] - Analysis of monoclonal antibody to DUT on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: dUTPase Antibody (1C9) [H00001854-M01] - Analysis of monoclonal antibody to DUT on formalin-fixed paraffin-embedded human colon. Antibody concentration 1 ug/ml.
Sandwich ELISA: dUTPase Antibody (1C9) [H00001854-M01] - Detection limit for recombinant GST tagged DUT is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

dUTPase Antibody (1C9) Summary

Immunogen
DUT (AAH33645 68 a.a. - 164 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Specificity
DUT - dUTP pyrophosphatase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DUT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for IHC-P, IF and ELISA.
Publications
Read Publication using H00001854-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for dUTPase Antibody (1C9)

  • deoxyuridine triphosphatase
  • dUTP pyrophosphatasedUTP nucleotidohydrolase
  • dUTPasedeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
  • EC 3.6.1.23
  • FLJ20622

Background

This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-87424
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-01184
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA

Publications for dUTPase Antibody (H00001854-M01)(1)

Reviews for dUTPase Antibody (H00001854-M01) (0)

There are no reviews for dUTPase Antibody (H00001854-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for dUTPase Antibody (H00001854-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional dUTPase Products

Bioinformatics Tool for dUTPase Antibody (H00001854-M01)

Discover related pathways, diseases and genes to dUTPase Antibody (H00001854-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for dUTPase Antibody (H00001854-M01)

Discover more about diseases related to dUTPase Antibody (H00001854-M01).
 

Pathways for dUTPase Antibody (H00001854-M01)

View related products by pathway.

PTMs for dUTPase Antibody (H00001854-M01)

Learn more about PTMs related to dUTPase Antibody (H00001854-M01).
 

Research Areas for dUTPase Antibody (H00001854-M01)

Find related products by research area.

Blogs on dUTPase

There are no specific blogs for dUTPase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our dUTPase Antibody (1C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol DUT
Entrez
OMIM
Uniprot