DUSP28 Antibody

Immunohistochemistry-Paraffin: DUSP28 Antibody [NBP1-94058] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: DUSP28 Antibody [NBP1-94058] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry: DUSP28 Antibody [NBP1-94058] - Staining of human fallopian tube shows no positivity in glandular cells as expected.

Product Discontinued

DUSP28 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVAEPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DUSP28
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DUSP28 Antibody

• dual specificity phosphatase 28
• DUSP26
• VHP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DUSP28