DUSP22 Antibody (3D3) - Azide and BSA Free

Western Blot: DUSP22 Antibody (3D3) [H00056940-M01] - Analysis of DUSP22 over-expressed 293 cell line, cotransfected with DUSP22 Validated Chimera RNAi ( Cat # H00056940-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DUSP22 monoclonal antibody (M01), clone 3D3 (Cat # H00056940-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: DUSP22 Antibody (3D3) [H00056940-M01] - Analysis of DUSP22 expression in transfected 293T cell line by DUSP22 monoclonal antibody (M01), clone 3D3.Lane 1: DUSP22 transfected lysate(20.9 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA, Mycoplasma
• Clone: 3D3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DUSP22 Antibody (3D3) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse DUSP22 Antibody (3D3) - Azide and BSA Free (H00056940-M01) is a monoclonal antibody validated for use in WB and ELISA. Anti-DUSP22 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: DUSP22 (NP_064570, 112 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
• Localization: Cytoplasm. Nucleus
• Specificity: DUSP22 - dual specificity phosphatase 22
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DUSP22
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Western Blot 1:500RNAi Validation
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DUSP22 Antibody (3D3) - Azide and BSA Free

• dual specificity phosphatase 22
• dual specificity protein phosphatase 22
• EC 3.1.3.16
• EC 3.1.3.48
• FLJ35864
• homolog of mouse dual specificity phosphatase LMW-DSP2
• JKAP
• JNK-stimulating phosphatase 1
• JSP-1
• JSP1JNK-stimulatory phosphatase-1
• LMWDSP2
• LMW-DSP2
• Low molecular weight dual specificity phosphatase 2
• Mitogen-activated protein kinase phosphatase x
• MKP-x
• MKPXMAP kinase phosphatase x
• VHX

Background

Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase /c-Jun N-terminal kinase (SAPK/JNK)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DUSP22 Antibody (H00056940-M01)(4)

Publications using H00056940-M01

• Lin H, Ho H, Chang C et al. DUSP22 suppresses prostate cancer proliferation by targeting the EGFR-AR axis. FASEB J. 2019-11-05 [PMID: 31693867]
• Sanchez-Mut JV, Aso E, Heyn H et al. Promoter hypermethylation of the phosphatase DUSP22 mediates PKA-dependent TAU phosphorylation and CREB activation in Alzheimer's disease. Hippocampus. 2014-01-16 [PMID: 24436131]
• Li JP, Fu YN, Chen YR, Tan TH. JNK Pathway-associated Phosphatase Dephosphorylates Focal Adhesion Kinase and Suppresses Cell Migration. J Biol Chem. 2010-02-19 [PMID: 20018849]
• Li JP, Fu YN, Chen YR, Tan TH. JNK pathway-associated phosphatase dephosphorylates focal adhesion kinase and suppresses cell migration. J Biol Chem 285(8):5472-8. 2010-02-19 [PMID: 2001884]

Bioinformatics

• Gene Symbol: DUSP22
• Entrez:
  • 56940(Human)
• Uniprot:
  • NP_064570(Human)