DUSP22 Antibody (3D3) - Azide and BSA Free Summary
| Immunogen |
DUSP22 (NP_064570, 112 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL |
| Localization |
Cytoplasm. Nucleus |
| Specificity |
DUSP22 - dual specificity phosphatase 22 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
DUSP22 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Knockdown Validated
- Western Blot 1:500RNAi Validation
|
| Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DUSP22 Antibody (3D3) - Azide and BSA Free
Background
Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase /c-Jun N-terminal kinase (SAPK/JNK)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: WB, ELISA, Mycoplasma
Publications for DUSP22 Antibody (H00056940-M01)(4)
Showing Publications 1 -
4 of 4.
| Publications using H00056940-M01 |
Applications |
Species |
| Lin H, Ho H, Chang C et al. DUSP22 suppresses prostate cancer proliferation by targeting the EGFR-AR axis. FASEB J. 2019-11-05 [PMID: 31693867] |
|
|
| Sanchez-Mut JV, Aso E, Heyn H et al. Promoter hypermethylation of the phosphatase DUSP22 mediates PKA-dependent TAU phosphorylation and CREB activation in Alzheimer's disease. Hippocampus. 2014-01-16 [PMID: 24436131] |
|
|
| Li JP, Fu YN, Chen YR, Tan TH. JNK Pathway-associated Phosphatase Dephosphorylates Focal Adhesion Kinase and Suppresses Cell Migration. J Biol Chem. 2010-02-19 [PMID: 20018849] |
|
|
| Li JP, Fu YN, Chen YR, Tan TH. JNK pathway-associated phosphatase dephosphorylates focal adhesion kinase and suppresses cell migration. J Biol Chem 285(8):5472-8. 2010-02-19 [PMID: 2001884] |
|
|
Reviews for DUSP22 Antibody (H00056940-M01) (0)
There are no reviews for DUSP22 Antibody (H00056940-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DUSP22 Antibody (H00056940-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DUSP22 Products
Research Areas for DUSP22 Antibody (H00056940-M01)
Find related products by research area.
|
Blogs on DUSP22