DUSP10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DUSP10 Antibody [NBP1-82640] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DUSP10 Antibody [NBP1-82640] - Staining of human kidney shows strong cytoplasmic positivity with granular pattern in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DUSP10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DUSP10 Protein (NBP1-82640PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DUSP10 Antibody

  • dual specificity phosphatase 10
  • dual specificity phosphatase MKP-5
  • EC 3.1.3.16
  • EC 3.1.3.48
  • MAP kinase phosphatase 5
  • Mitogen-activated protein kinase phosphatase 5
  • MKP-5dual specificity protein phosphatase 10
  • MKP5serine/threonine specific protein phosphatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24501
Species: Hu, Mu, Bv, Pm
Applications: WB, IHC-P
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001848-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi

Publications for DUSP10 Antibody (NBP1-82640) (0)

There are no publications for DUSP10 Antibody (NBP1-82640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP10 Antibody (NBP1-82640) (0)

There are no reviews for DUSP10 Antibody (NBP1-82640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DUSP10 Antibody (NBP1-82640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUSP10 Products

Bioinformatics Tool for DUSP10 Antibody (NBP1-82640)

Discover related pathways, diseases and genes to DUSP10 Antibody (NBP1-82640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP10 Antibody (NBP1-82640)

Discover more about diseases related to DUSP10 Antibody (NBP1-82640).
 

Pathways for DUSP10 Antibody (NBP1-82640)

View related products by pathway.

PTMs for DUSP10 Antibody (NBP1-82640)

Learn more about PTMs related to DUSP10 Antibody (NBP1-82640).
 

Research Areas for DUSP10 Antibody (NBP1-82640)

Find related products by research area.

Blogs on DUSP10

There are no specific blogs for DUSP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP10