Dub3 Antibody (3G12)

Images

 
ELISA: Dub3 Antibody (3G12) [H00377630-M01] - Detection limit for recombinant GST tagged DUB3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dub3 Antibody (3G12) Summary

Immunogen
DUB3 (NP_958804, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ
Specificity
DUB3 - deubiquitinating enzyme 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP17L2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dub3 Antibody (3G12)

  • Deubiquitinating enzyme 17-like protein 2
  • Deubiquitinating protein 3
  • DUB-3
  • DUB3deubiquitinating enzyme 3
  • EC 3.1.2.15
  • EC 3.4.19.12
  • ubiquitin carboxyl-terminal hydrolase 17-like protein 2
  • ubiquitin specific peptidase 17-like 2
  • ubiquitin thioesterase 17-like protein 2
  • Ubiquitin thiolesterase 17-like protein 2
  • Ubiquitin-specific-processing protease 17-like protein 2

Background

DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1648
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-86906
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NBP2-55335
Species: Hu
Applications: ICC/IF, WB
D6050
Species: Hu
Applications: ELISA
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP1-59922
Species: Hu
Applications: IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
NBP2-27419
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NB600-260
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-257
Species: Hu, Mu
Applications: IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
MAB4260
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
1726-JG
Species: Hu
Applications: BA
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
H00377630-M01
Species: Hu
Applications: WB, ELISA

Publications for Dub3 Antibody (H00377630-M01) (0)

There are no publications for Dub3 Antibody (H00377630-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dub3 Antibody (H00377630-M01) (0)

There are no reviews for Dub3 Antibody (H00377630-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dub3 Antibody (H00377630-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dub3 Products

Array H00377630-M01

Bioinformatics Tool for Dub3 Antibody (H00377630-M01)

Discover related pathways, diseases and genes to Dub3 Antibody (H00377630-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dub3 Antibody (H00377630-M01)

Discover more about diseases related to Dub3 Antibody (H00377630-M01).
 

Pathways for Dub3 Antibody (H00377630-M01)

View related products by pathway.

Blogs on Dub3

There are no specific blogs for Dub3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dub3 Antibody (3G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol USP17L2
Entrez
Uniprot