Home » Dub3 » Dub3 Antibodies » Dub3 Antibody (3G12)

Dub3 Antibody (3G12)

 Submit a Review

Images

 
(
Enlarge)
ELISA: Dub3 Antibody (3G12) [H00377630-M01] - Detection limit for recombinant GST tagged DUB3 is approximately 0.3ng/ml as a capture antibody.
ELISA: Dub3 Antibody (3G12) [H00377630-M01] - Detection limit for recombinant GST tagged DUB3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Dub3 Antibody (3G12) Summary

Immunogen
DUB3 (NP_958804, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ
Specificity
DUB3 - deubiquitinating enzyme 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP17L2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dub3 Antibody (3G12)

  • Deubiquitinating enzyme 17-like protein 2
  • Deubiquitinating protein 3
  • DUB-3
  • DUB3deubiquitinating enzyme 3
  • EC 3.1.2.15
  • EC 3.4.19.12
  • ubiquitin carboxyl-terminal hydrolase 17-like protein 2
  • ubiquitin specific peptidase 17-like 2
  • ubiquitin thioesterase 17-like protein 2
  • Ubiquitin thiolesterase 17-like protein 2
  • Ubiquitin-specific-processing protease 17-like protein 2

Background

DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDC25A Antibody
(336445)
MAB1648
Western blot shows lysates of MCF‑7 human breast cancer cell line, CTLL‑2 mouse cytotoxic T cell line, and Nb2‑11 rat lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat CDC25A Monoclonal Antibody (Catalog # MAB1648) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for CDC25A at approximately 55-60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
ZFP36L1 Antibody
NBP2-86906
Immunohistochemistry-Paraffin: ZFP36L1 Antibody [NBP2-86906] - Rabbit Anti-ZFP36L1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy2/3.
Immunohistochemistry-Paraffin: ZFP36L1 Antibody [NBP2-86906] - Rabbit Anti-ZFP36L1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult liver. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3.
Immunohistochemistry-Paraffin: ZFP36L1 Antibody [NBP2-86906] - Rabbit Anti-ZFP36L1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue. Observed Staining: Cytoplasm in smooth muscle cells in portal vein.
Species: Hu
Applications: IHC, IHC-P, WB
HDAC9 Antibody -
BSA Free
NBP2-03993
Western Blot: HDAC9 Antibody [NBP2-03993] - Analysis of HDAC-9 in human HeLa cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) and mouse RAW cell lysate using this antibody. 0 ug/ml, 1.0 ug/ml and 0.5 ug/ml respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Review)
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
BRF1 Antibody
NBP2-55335
Western Blot: BRF1 Antibody [NBP2-55335] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/Immunofluorescence: BRF1 Antibody [NBP2-55335] - Staining of human cell line MCF7 shows localization to nucleoplasm & nuclear bodies.
Species: Hu
Applications: ICC/IF, WB
IL-6 [HRP]
D6050
(32 Reviews)
(605 Publications)
Species: Hu
Applications: ELISA
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.
IL-8/CXCL8 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(10 Reviews)
(104 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
RCE1 Antibody
NBP1-59922
Western Blot: RCE1 Antibody [NBP1-59922] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: RCE1 Antibody [NBP1-59922] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Species: Hu
Applications: IHC, IHC-P, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(27 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MDA5 Antibody
NB110-1244
Immunohistochemistry-Paraffin: MDA5 Antibody [NB110-1244] - Staining in paraffin embedded Human Pancreas. Antibody at 10 ug/mL. Microwaved antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
Flow Cytometry: MDA5 Antibody [NB110-1244] - Flow cytometric analysis of paraformaldehyde fixed K562 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(8 Publications)
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
RIG-I Antibody -
BSA Free
NBP2-27419
Immunohistochemistry-Paraffin: RIG-I Antibody [NBP2-27419] - Formalin-fixed, paraffin-embedded human uterus stained with RIG-I antibody at 10 ug/ml.
Immunohistochemistry-Paraffin: RIG-I Antibody [NBP2-27419] - Formalin-fixed, paraffin-embedded human breast stained with RIG-I antibody at 10 ug/ml.
Western Blot: RIG-I Antibody [NBP2-27419] - Analysis of 293 lysate in the 1) absence and 2) presence of immunizing peptide using RIG-I antibody at 3 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Publication)
Species: Hu, Pm
Applications: IHC, IHC-P, WB
MTA1 Antibody
NB600-260
Immunohistochemistry-Paraffin: MTA1 Antibody [NB600-260] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- MTA1 used at a dilution of 1:1,000 (1 ug/ml). Detection: DAB
Immunoprecipitation: MTA1 Antibody [NB600-260] - Detection of human MTA1 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-MTA1 antibody NB600-260 (lot NB600-260-2) used for IP at 6 ug per reaction. MTA1 was also immunoprecipitated by rabbit anti-MTA1 antibody NB600-260-1. For blotting immunoprecipitated MTA1, NB600-260 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: MTA1 Antibody [NB600-260] - Detection of Human and Mouse MTA1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-MTA1 antibody NB600-260 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
SDS3 Antibody
NB100-257
Immunoprecipitation: SDS3 Antibody [NB100-257] - Detection of human SDS3 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified goat anti-SDS3 antibody NB100-257 (lot 2) used for IP at 6 ug per reaction. SDS3 was also immunoprecipitated by a previous lot of this antibody (lot 1) and rabbit anti-SDS3 antibody NB100-93318. For blotting immunoprecipitated SDS3, NB100-257 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: SDS3 Antibody [NB100-257] - Detection of Human and Mouse SDS3 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified goat anti-SDS3 antibody NB100-257 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(3 Publications)
Species: Hu, Mu
Applications: IP, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Flow Cytometry: PCNA Antibody (PC10) [NB500-106] - An intracellular stain was performed on HepG2 cells with PCNA Antibody (PC10) NB500-106G (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 488.
(5 Reviews)
(38 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Jak1 Antibody
(413104) [Unconjugate
MAB4260
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, K562 human chronic myelogenous leukemia cell line, A20 mouse B cell lymphoma cell line, and L1.2 mouse pro‑B cell line. PVDF membrane was probed with 1 µg/mL of Rat Anti-Human/Mouse/Rat Jak1 Monoclonal Antibody (Catalog # MAB4260) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for Jak1 at approximately 130 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Jak1 was detected in immersion fixed paraffin-embedded sections of human epidermis using 25 µg/mL Rat Anti-Human/Mouse/Rat Jak1 Monoclonal Antibody (Catalog # MAB4260) overnight at 4 °C. Tissue was stained with the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Jurkat human acute T cell leukemia cell line was stained with Rat Anti-Human/Mouse/Rat Jak1 Monoclonal Antibody (Catalog # MAB4260, filled histogram) or isotype control antibody (Catalog # MAB0061, open histogram), followed by Phycoerythrin-conjugated Anti-Rat IgG F(ab')2 Secondary Antibody (Catalog # F0105B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(4 Reviews)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human liver tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Jagged 2
[Unconjugated]
1726-JG
Jagged 2 [Unconjugated]
(11 Publications)
Species: Hu
Applications: BA
Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human liver cancer tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human skin tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Dub3 Antibody
(3G12)
H00377630-M01
Dub3 Antibody (3G12)
Species: Hu
Applications: WB, ELISA

Publications for Dub3 Antibody (H00377630-M01) (0)

There are no publications for Dub3 Antibody (H00377630-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dub3 Antibody (H00377630-M01) (0)

There are no reviews for Dub3 Antibody (H00377630-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dub3 Antibody (H00377630-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dub3 Products

Array H00377630-M01

Bioinformatics Tool for Dub3 Antibody (H00377630-M01)

Discover related pathways, diseases and genes to Dub3 Antibody (H00377630-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dub3 Antibody (H00377630-M01)

Discover more about diseases related to Dub3 Antibody (H00377630-M01).
 

Pathways for Dub3 Antibody (H00377630-M01)

View related products by pathway.

Blogs on Dub3

There are no specific blogs for Dub3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dub3 Antibody (3G12) and receive a gift card or discount.


Bioinformatics

Gene Symbol USP17L2
Entrez
Uniprot