DSN1 Antibody

Images

 
Western Blot: DSN1 Antibody [NBP2-87304] - WB Suggested Anti-DSN1 Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole CellDSN1 is supported by BioGPS gene expression data to be expressed in MCF7

Product Details

Summary
Reactivity Hu, Rt, Bv, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DSN1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DSN1. Peptide sequence: MTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFM The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%), Guinea Pig (93%), Bovine (93%), Rabbit (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
DSN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DSN1 Antibody

  • C20orf172
  • chromosome 20 open reading frame 172
  • dJ469A13.2
  • DSN1, MIND kinetochore complex component, homolog (S. cerevisiae)
  • FLJ13346
  • hKNL-3
  • kinetochore null 3 homolog
  • kinetochore-associated protein DSN1 homolog
  • KNL3
  • MIS13MGC32987

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2359
Species: Hu
Applications: WB, IHC, IP
NB100-2575
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NB100-2586
Species: Hu
Applications: WB, ICC/IF, IP
NB100-338
Species: Hu, Mu, Ha
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP, PLA
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67349
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00002491-B01P
Species: Hu
Applications: WB, ICC/IF
H00010910-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47924
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-85504
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-87304
Species: Hu, Rt, Bv, Gp, Rb
Applications: WB

Publications for DSN1 Antibody (NBP2-87304) (0)

There are no publications for DSN1 Antibody (NBP2-87304).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DSN1 Antibody (NBP2-87304) (0)

There are no reviews for DSN1 Antibody (NBP2-87304). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DSN1 Antibody (NBP2-87304) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DSN1 Products

Bioinformatics Tool for DSN1 Antibody (NBP2-87304)

Discover related pathways, diseases and genes to DSN1 Antibody (NBP2-87304). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DSN1 Antibody (NBP2-87304)

Discover more about diseases related to DSN1 Antibody (NBP2-87304).
 

Pathways for DSN1 Antibody (NBP2-87304)

View related products by pathway.

PTMs for DSN1 Antibody (NBP2-87304)

Learn more about PTMs related to DSN1 Antibody (NBP2-87304).

Blogs on DSN1

There are no specific blogs for DSN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DSN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSN1