DSN1 Antibody (2A7) - Azide and BSA Free

Sandwich ELISA: DSN1 Antibody (2A7) [H00079980-M01] - Detection limit for recombinant GST tagged DSN1 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2A7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DSN1 Antibody (2A7) - Azide and BSA Free Summary

• Immunogen: C20orf172 (NP_079194.2, 257 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSC
• Specificity: C20orf172 - chromosome 20 open reading frame 172 (2A7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DSN1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DSN1 Antibody (2A7) - Azide and BSA Free

• C20orf172
• chromosome 20 open reading frame 172
• dJ469A13.2
• DSN1, MIND kinetochore complex component, homolog (S. cerevisiae)
• FLJ13346
• hKNL-3
• kinetochore null 3 homolog
• kinetochore-associated protein DSN1 homolog
• KNL3
• MIS13MGC32987

Background

The DSN1 gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex.The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternativesplicing results in m

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DSN1
• Entrez:
  • 79980(Human)
• Uniprot:
  • NP_079194(Human)