DSCC1 Antibody

Images

 
Western Blot: DSCC1 Antibody [NBP2-33275] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-170
Immunohistochemistry-Paraffin: DSCC1 Antibody [NBP2-33275] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DSCC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTEEDIAPYIQDLCGEKQTIGALLTKYSHSSMQNGVKVYNSRRP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSCC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DSCC1 Protein (NBP2-33275PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DSCC1 Antibody

  • DCC1MGC5528
  • defective in sister chromatid cohesion 1 homolog (S. cerevisiae)
  • Defective in sister chromatid cohesion protein 1 homolog
  • hDCC1
  • sister chromatid cohesion protein DCC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-03346
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-30490
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF2147
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-56629
Species: Hu
Applications: WB
NBP1-03414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-33275
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DSCC1 Antibody (NBP2-33275) (0)

There are no publications for DSCC1 Antibody (NBP2-33275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DSCC1 Antibody (NBP2-33275) (0)

There are no reviews for DSCC1 Antibody (NBP2-33275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DSCC1 Antibody (NBP2-33275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DSCC1 Products

Bioinformatics Tool for DSCC1 Antibody (NBP2-33275)

Discover related pathways, diseases and genes to DSCC1 Antibody (NBP2-33275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DSCC1 Antibody (NBP2-33275)

Discover more about diseases related to DSCC1 Antibody (NBP2-33275).
 

Pathways for DSCC1 Antibody (NBP2-33275)

View related products by pathway.

Blogs on DSCC1

There are no specific blogs for DSCC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DSCC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSCC1
Uniprot