Home » DRG1 » DRG1 Proteins » DRG1 Recombinant Protein Antigen

DRG1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DRG1 Protein (NBP1-82591PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

DRG1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DRG1.

Source: E.coli

Amino Acid Sequence: ELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYT
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DRG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82591.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DRG1 Recombinant Protein Antigen

  • developmentally regulated GTP binding protein 1
  • developmentally regulated GTP-binding protein 1
  • developmentally-regulated GTP-binding protein 1
  • DKFZp434N1827
  • DRG-1
  • NEDD3
  • NEDD-3
  • Neural precursor cell expressed developmentally down-regulated protein 3
  • neural precursor cell expressed, developmentally down-regulated 3

Background

DRG1 may play a role in cell proliferation, differentiation and death

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NDRG1 Antibody
NBP1-86636
Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in human cell lines HEK293 and MCF-7. Corresponding NDRG1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Analysis in human prostate and skeletal muscle tissues. Corresponding NDRG1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human colon shows strong membranous positivity in glandular cells.
(5 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
n-Myc Antibody
(NMYC-1) - BSA Free
NB200-109
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in human heart tissue.
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in IMR32 whole cell lysate.
Immunocytochemistry/Immunofluorescence: n-Myc Antibody (NMYC-1) [NB200-109] - The n-Myc (NMYC-1) antibody was tested in NTERA2 cells at a 1:50 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
(6 Publications)
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
STK38 Antibody
(2G8-1F3)
H00011329-M01
Immunohistochemistry-Paraffin: STK38 Antibody (2G8-1F3) [H00011329-M01] - STK38 ( Cat# H00011329-M01 ) on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]
Immunocytochemistry/Immunofluorescence: STK38 Antibody (2G8-1F3) [H00011329-M01] - Analysis of monoclonal antibody to STK38 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: STK38 Antibody (2G8-1F3) [H00011329-M01] - Analysis of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue Antibody concentration 5 ug/ml.
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
YB1 Antibody
NBP1-89945
Immunohistochemistry-Paraffin: YB1 Antibody [NBP1-89945] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: YB1 Antibody [NBP1-89945] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: YB1 Antibody [NBP1-89945] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
DRG2 Antibody
NBP1-89461
Immunocytochemistry/Immunofluorescence: DRG2 Antibody [NBP1-89461] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DRG2 Antibody [NBP1-89461] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
VEGF [HRP]
DVE00
(621 Publications)
Species: Hu
Applications: ELISA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western blot shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery. PVDF membrane was probed with 0.5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-c‑Jun (S63) at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
c‑Junphosphorylated at S63 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line treated with Anisomycin using Rabbit Anti-HumanPhospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) at 1 μg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery, loaded at 0.2 mg/mL. A specific band was detected for Phospho-c‑Jun (S63) at approximately 49 kDa (as indicated) using 5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
PTEN Antibody
[Unconjugated]
AF847
Western blot shows lysates of mouse and rat brain tissue, A431 human epithelial carcinoma cell line, and MRC-5 human embryonic lung fibroblast cell line. PVDF membrane was probed with 0.1 µg/mL Rabbit Anti-Human/Mouse/Rat PTEN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF847) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). For additional reference, recombinant human PTEN (5 ng) was included. A specific band for PTEN was detected at approximately 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Simple Western lane view shows lysates of A431 human epithelial carcinoma cell line and HeLa human cervical epithelial carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PTEN at approximately 60 kDa (as indicated) using 1 µg/mL of Rabbit Anti-Human/Mouse/Rat PTEN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF847). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and PTEN knockout HeLa cell line (KO). PVDF membrane was probed with 0.1 µg/mL of Rabbit Anti-Human/Mouse/Rat PTEN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF847) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for PTEN at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(8 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(16 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MKP-1/DUSP1
Antibody (JJ0930)
NBP2-67909
Flow Cytometry: MKP-1/DUSP1 Antibody (JJ0930) [NBP2-67909] - Analysis of HepG2 cells with DUSP1 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Immunohistochemistry-Paraffin: MKP-1/DUSP1 Antibody (JJ0930) [NBP2-67909] - Analysis of paraffin-embedded human lung cancer tissue using anti-DUSP1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: MKP-1/DUSP1 Antibody (JJ0930) [NBP2-67909] - Analysis of paraffin-embedded mouse lung tissue using anti-DUSP1 antibody. Counter stained with hematoxylin.
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Kallikrein 3/PSA
[HRP]
DKK300
(16 Publications)
Species: Hu
Applications: ELISA
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NGFRAP1/BEX3/NADE
Antibody (672911) [Un ...
MAB6858
NGFRAP1/BEX3 was detected in immersion fixed paraffin-embedded sections of human prostate using Mouse Anti-Human NGFRAP1/BEX3 Monoclonal Antibody (Catalog # MAB6858) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HT‑29 human colon adenocarcinoma cell line, Balb/3T3 mouse embryonic fibroblast cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human NGFRAP1/BEX3 Monoclonal Antibody (Catalog # MAB6858) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for NGFRAP1/BEX3 at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu
Applications: IHC, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
E-Cadherin
Antibody [Unconjugate
AF748
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
E‑Cadherin was detected in perfusion fixed frozen sections of mouse skin using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membranes in keratinocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
E‑Cadherin was detected in immersion fixed mouse intestinal organoids using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL001) and counterstained with DAPI (blue). Magnification shown at 100X (upper panel) and 40X (lower panel). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(55 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
RPL24/RLP24
Antibody
NBP2-38971
Immunocytochemistry/Immunofluorescence: RPL24/RLP24 Antibody [NBP2-38971] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971] - Staining of human colon shows strong positivity in nucleoli in glandular cells.
Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971] - Staining of human kidney shows strong positivity in nucleoli in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SERINC3 Antibody
NBP2-13296
Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296] - Staining of human cerebral cortex shows moderate positivity in neuronal cells.
Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Species: Hu
Applications: IHC, IHC-P, WB
DRG1 Recombinant
Protein Antigen
NBP1-82591PEP
DRG1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for DRG1 Protein (NBP1-82591PEP) (0)

There are no publications for DRG1 Protein (NBP1-82591PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRG1 Protein (NBP1-82591PEP) (0)

There are no reviews for DRG1 Protein (NBP1-82591PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DRG1 Protein (NBP1-82591PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DRG1 Products

Bioinformatics Tool for DRG1 Protein (NBP1-82591PEP)

Discover related pathways, diseases and genes to DRG1 Protein (NBP1-82591PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRG1 Protein (NBP1-82591PEP)

Discover more about diseases related to DRG1 Protein (NBP1-82591PEP).
 

Pathways for DRG1 Protein (NBP1-82591PEP)

View related products by pathway.

PTMs for DRG1 Protein (NBP1-82591PEP)

Learn more about PTMs related to DRG1 Protein (NBP1-82591PEP).
 

Research Areas for DRG1 Protein (NBP1-82591PEP)

Find related products by research area.

Blogs on DRG1

There are no specific blogs for DRG1, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DRG1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DRG1