DRB1 Antibody

Images

 
Western Blot: DRB1 Antibody [NBP1-80481] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DRB1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human RBM45. Peptide sequence MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM45
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RBM45 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DRB1 Antibody

  • developmentally regulated RNA-binding protein 1
  • Developmentally-regulated RNA-binding protein 1
  • DRB1FLJ44612
  • DRBP1
  • MGC42237
  • putative RNA binding protein RB-1
  • RB-1
  • RNA binding motif protein 45
  • RNA-binding motif protein 45
  • RNA-binding protein 45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2705
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP1-89688
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-17101
Species: Hu
Applications: IHC, IHC-P
NBP2-14984
Species: Hu
Applications: WB, IHC, IHC-P
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB

Publications for DRB1 Antibody (NBP1-80481) (0)

There are no publications for DRB1 Antibody (NBP1-80481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRB1 Antibody (NBP1-80481) (0)

There are no reviews for DRB1 Antibody (NBP1-80481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DRB1 Antibody (NBP1-80481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-80481

Bioinformatics Tool for DRB1 Antibody (NBP1-80481)

Discover related pathways, diseases and genes to DRB1 Antibody (NBP1-80481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRB1 Antibody (NBP1-80481)

Discover more about diseases related to DRB1 Antibody (NBP1-80481).
 

Pathways for DRB1 Antibody (NBP1-80481)

View related products by pathway.

Blogs on DRB1

There are no specific blogs for DRB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM45
Uniprot