DRAM Antibody - Azide and BSA Free

Western Blot: DRAM Antibody [NBP2-92236] - Analysis of extracts of various cell lines, using DRAM at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 15s.

Product Discontinued

DRAM Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRAM1 (NP_060840.2). GLVGCFGMGIVANFQELAVPVVHDGGALLAFVCGVVYTLLQSIISYKSCPQWNSLSTCHIRMVISAVSCAAVIPMIVCASLISITKLEWNPREKDYVYHVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DRAM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for DRAM Antibody - Azide and BSA Free

• Damage-regulated autophagy modulator
• DNA damage-regulated autophagy modulator protein 1
• DNA-damage regulated autophagy modulator 1
• DRAMFLJ11259

Background

DRAM is regulated as part of the p53 tumor suppressor pathway. The gene encodes a lysosomal membrane protein that is required for the induction of autophagy by the pathway. Decreased transcriptional expression of this gene is associated with various tumors. This gene has a pseudogene on chromosome 4.; Lysosomal modulator of autophagy that plays a central role in p53/TP53-mediated apoptosis. Not involved in p73/TP73-mediated autophagy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: DRAM1